Navigation Links
VIMS team glides into polar research
Date:1/19/2011

enna can send the collected data to researchers and receive guidance for its next dive. Data is transmitted via the Iridium satellite network.

The potential of gliders

Lacking a motor or propeller, gliders zigzag up and down through the water using a set of fins to translate changes in buoyancy into lateral motion. Their top speed is about one-half mile per hour. A small battery powers the buoyancy changes by forcing mineral oil in and out of an inflatable bladder. Moving the battery fore or aft within the hull shifts the center of gravity to control pitch, rotating it from side to side controls roll.

Smith says that gliders bring several potential benefits to ocean research. For one, because they're propelled by buoyancy changes rather than an energy-hungry motor, they can remain in the water for months at a time before needing a recharge (the current world record is a 4,500-mile transatlantic crossing that lasted 221 days, using the equivalent power of just 3 Christmas tree lights). Motor-driven underwater robots are limited to missions of a few days at most.

A glider's small size and simplicity (with only a few moving parts) also makes it relatively inexpensive to own and operate, especially compared to the costs of ship-based ocean research. Smith's gliderdeveloped at the Applied Physics Laboratory at the University of Washington and now sold commercially by iRobot, Inc. (maker of the Roomba vacuum cleaning robot)cost $150,000. A single ship-day, including costs for fuel and crew, can run up to $60,000.

Dr. Mark Patterson, head of the Autonomous Systems Laboratory at VIMS and developer of the Fetch autonomous underwater vehicle (AUV), notes that gliders and other AUVs hold great promise for solving one of the oldest problems in oceanography: the fact that "the ocean changes faster than we have the ability to observe."

"Traditional ship-based studies can only provide snapshots of the constantly changing ocea
'/>"/>

Contact: David Malmquist
davem@vims.edu
804-684-7011
Virginia Institute of Marine Science
Source:Eurekalert  

Page: 1 2 3 4

Related biology news :

1. Polar bears no longer on thin ice: researchers say polar bears could face brighter future
2. Polar bears: On thin ice? Extinction can be averted, scientists say
3. New study about Arctic sea-ice, greenhouse gases and polar bear habitat
4. Its time for Europe to step up research in the polar regions
5. Biologists report more bad news for polar bears
6. Council of Science and Humanities recommends building of Polarstern II
7. Polar bears cant eat geese into extinction
8. Highlight of the Polarstern expedition
9. Scientists call for a new strategy for polar ocean observation
10. New link identified for bipolar disorder
11. Beyond polar bears? Experts look for a new vision of climate change to combat skepticism
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
VIMS team glides into polar research
(Date:6/18/2013)... Kingdom, the Energy Department,s National Renewable Energy Laboratory ... published a paper describing a novel cellulose-degrading enzyme ... , commonly known as the gribble. , ... relatively unique ability to produce their own enzymes ... the biomass they eat. New biomass-degrading enzymes from ...
(Date:6/18/2013)... not a hacker lab. At Brandeis University, sophisticated ... are helping scientists understand the complex interplay between ... the virus, outer "shell" critical for replication. ... what we are finding will help researchers alter ... post-doctoral fellow Jason Perlmutter, first author of the ...
(Date:6/18/2013)... Torrent, Ph.D., Medical Research Council, Laboratory of Molecular ... a 2013 ICAAC Young Investigator Award. Torrent is ... developing the first algorithm to predict antimicrobial regions ... said, "we are now applying this algorithm to ... antimicrobial peptide leads with very appealing results." ...
Breaking Biology News(10 mins):Novel enzyme from tiny gribble could prove a boon for biofuels research 2Computer modeling technique goes viral at Brandeis 2The American Society for Microbiology honors Marc Torrent 2
... could help ships sailing smoothly. The growth of marine ... major cause of increased energy costs in the naval ... this so called 'bio-fouling'. , Ralph Liedert from the ... work on the application of artificial shark skin in ...
... that provides a vital passage through a bacterium's outer ... is built of the 'wrong' material, scientists at The ... a finding that has long-term implications for understanding diseases ... disease, and mad cow disease. , The paper in ...
... of different items by scanning the tiny barcode printed ... could make it just as easy to identify genes, ... tagging them with color-coded probes made out of synthetic ... Luo, Cornell assistant professor of biological engineering, has created ...
Cached Biology News:Beyond genes: Lipid helps cell wall protein fold into proper shape 2Beyond genes: Lipid helps cell wall protein fold into proper shape 3Tagging pathogens with synthetic DNA 'barcodes' 2Tagging pathogens with synthetic DNA 'barcodes' 3
(Date:6/18/2013)... WILMINGTON, Delaware , June 18, 2013 /PRNewswire/ ... to announce the release of the HELM biomolecular ... permissive open source MIT licence. HELM ... of a wide range of biomolecules (e.g. proteins, ... render existing small-molecule and sequence-based informatics methodologies impractical ...
(Date:6/18/2013)... -- The "Bioinformatics Market By Sector (Molecular Medicine, Agriculture, ... Data Analysis Services) & Application (Genomics, Proteomics & Drug Design) - Global ... Restraints, and Opportunities in North America , ... and Rest of World. Browse , ... Figures 364 Pages and an in-depth ...
(Date:6/18/2013)... , June 18, 2013 ... ) has announced the addition of the ... and Companies " to their offering. ... report briefly reviews basics of human genome ... applications. Current large and small sequencers are ...
(Date:6/18/2013)... DUBLIN , June 18, 2013 ... Markets ( http://www.researchandmarkets.com/research/cmbgcv/north_american ) has announced ... American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes ... Radiation Therapy (I131, Y-90)], [Applications (Cancer/Oncology, ... to 2017" report to their ...
Breaking Biology Technology:The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools 2Bioinformatics Market Worth $7.5 Billion by 2017 2Bioinformatics Market Worth $7.5 Billion by 2017 3DNA Sequencing: Technologies, Markets and Companies - 2013 Report 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 3
... that allow nanoparticles to assemble themselves into designer materials ... of Iowa State University and the Ames Laboratory reports ... Science . Travesset, an associate professor of physics ... of Energy,s Ames Laboratory, writes in the journal,s Perspectives ...
... today announced that Jeff Liter has been appointed as ... "Jeff,s diverse background in all aspects of corporate development ... Said Matt McManus, President and CEO, PrimeraDx.  "PrimeraDx,s strategy ... Plex system in the MDx market and define ...
... from the Faculty of Biology and Biotechnology at the ... of Biological Chemistry explaining why enzymes used for ... In collaboration with researchers from Berlin, they used spectroscopic ... that lead to the inactivation of the enzyme,s iron ...
Cached Biology Technology:Iowa State, Ames Lab physicist says nanoparticle assembly is like building with LEGOs 2PrimeraDx Appoints Jeff Liter as VP of Corporate Development 2If oxygen becomes the undoing of proteins 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: