Navigation Links
University of Texas at Austin engineer elected to American Academy of Arts and Sciences
Date:4/22/2009

AUSTIN, TexasAdam Heller, an acclaimed chemical engineering research professor and professor emeritus at The University of Texas at Austin, has been elected a fellow into the American Academy of Arts & Sciences (AAAS), along with Nobel Peace Prize laureate Nelson Mandela, actor James Earl Jones, U.S. Secretary of Defense Robert Gates and singer/ humanitarian Bono.

"Dr. Heller is an outstanding scientist who translates his discoveries into technology that helps people," said Gregory L. Fenves, dean of the Cockrell School of Engineering. "His election as an AAAS fellow is richly deserved."

As a child, Heller was detained in a concentration camp, but survived the Holocaust and earned degrees from the Hebrew University in Jerusalem. He immigrated to the United States in 1962. After postdoctoral work at the University of California, Berkeley and Bell Laboratories, he joined GTE Laboratories in 1964, where he developed the first inorganic liquid lasers and non-rechargeable lithium batteries. On his return to Bell Laboratories in 1975, he built efficient electrochemical solar cells and managed research on high-density chip interconnection technology.

In 1988 he joined The University of Texas at Austin as the Ernest Cockrell Sr. Chair in Engineering, designing photocatalysts applied in self-cleaning windows. At the university he also addressed his career's most important challenge: integrating electronics with biology to improve the lives of people with illnesses. He and members of his team were issued the core patents on electrical wiring of enzymes. These patents formed the basis of the continuous glucose monitor for diabetes management known as FreeStyle Navigator of TheraSense, a company founded by Heller's son, Ephraim.

With Ephraim, Ben Feldman, and others of TheraSense, Heller also developed a technology of coulometrically testing glucose levels using blood samples so small that they could be painlessly obtained. People suffe
'/>"/>

Contact: Adam Heller
heller@che.utexas.edu
512-471-8874
University of Texas at Austin
Source:Eurekalert  

Page: 1 2 3

Related biology news :

1. International honor for University of East Anglia ocean researcher
2. Concordia University receives more than $22 million for genomics research
3. Case Western Reserve University engineers hit pay dirt with clay mixture
4. Case Western Reserve University receives $1.66m grant from NIH for otoprotection research
5. Ben-Gurion University of the Negev signs collaborative contract with Bayer CropScience
6. CFI awards $854,098 to University of Montreal and partners
7. University of Michigan installs second Genomatix Genome Analyzer
8. University of Kansas graduate student researcher takes aim at deadly brain tumors
9. Two innovative University of Texas at Austin biologists become HHMI Early Career Scientists
10. Intruder alert: Tel Aviv Universitys Smart Dew will find you!
11. Nanyang Technological University and University of California, Berkeley pursue research alliance
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
University of Texas at Austin engineer elected to American Academy of Arts and Sciences
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
(Date:12/19/2014)... The empty capsules market is experiencing ... and technological innovations in the empty capsules market. ... the growth of the empty capsules market. , ... Scope of Report , The report will enrich ... firms to gauge the pulse of the market ...
(Date:12/19/2014)... -- Relmada Therapeutics, Inc. (OTCQB: RLMD), a clinical-stage company ... announced the results of its annual general meeting of ... year in Relmada,s history and it set the stage ... Sergio Traversa , chief executive officer of Relmada. "Over ... human resource and clinical development objectives that position Relmada ...
(Date:12/17/2014)... BASKING RIDGE, N.J. (PRWEB) December 17, 2014 ... Ipsen (Euronext: IPN; ADR: IPSEY), ... 120 mg (referred to as Somatuline®) was approved ... for the treatment of gastroenteropancreatic neuroendocrine tumors (GEP-NETs) ... differentiated, locally advanced or metastatic disease to improve ...
(Date:12/17/2014)... Audacity, a leading California-based health and ... the Huntsworth Health Group, is proud to announce the ... her role, Gonzales will serve as Senior Vice President ... to welcome a talent of Jamie’s caliber to the ... “She is a proven healthcare innovation leader and brand ...
Breaking Biology Technology:Empty Capsules Market Hit to Reach $1,820 Million by 2019 - New Research Report by MarketsandMarkets 2Empty Capsules Market Hit to Reach $1,820 Million by 2019 - New Research Report by MarketsandMarkets 3Empty Capsules Market Hit to Reach $1,820 Million by 2019 - New Research Report by MarketsandMarkets 4Relmada Therapeutics Announces Results of Annual Shareholders Meeting 2Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 2Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 3Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 4Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 5Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 6Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 7Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 8Audacity Welcomes Healthcare Communications Expert Jamie Gonzales as Senior Vice President of Client Services 2
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: