Navigation Links
UN: Rising reuse of wastewater in forecast but world lacks data on 'massive potential resource'
Date:9/4/2013

est the time and resources to fill the global data gap," adds author Manzoor Qadir of UNU-INWEH. "Better data will enable the research and policy community to enhance understanding and craft effective solutions that will benefit millions of producers and consumers worldwide."

Says the study, on which Tottori University and UNU-INWEH collaborated with the International Center for Agricultural Research in the Dry Areas (ICARDA), Syria, the International Water Management Institute (IWMI), Sri Lanka, and Hazara University, Pakistan: "The country level information aggregated at the regional and global levels would help in identifying the gaps in pertinent data availability and assessing the potential of wastewater in food, feed, and fish production at different scales."

Selected highlights

The study is the first ever to identify information gaps with respect to wastewater generation, treatment and use.

About 70% of the world's freshwater (up to 95% in some countries) is used for irrigation.

Competition for freshwater already exists among municipal, industrial, and agricultural sectors, particularly in water scarce areas. Agriculture has been yielding its share gradually to non-agricultural uses.

The combination of less freshwater allocation to agriculture and growing volumes of urban wastewater, is expected to continue and intensify, particularly in water scarce countries.

Agriculture in these countries will increasingly rely on alternative water resources, such as wastewater generated by non-agricultural activities in urban and peri-urban areas.

Under-reporting of wastewater generation, treatment and reuse might relate to fear of economic repercussions in agricultural trade due to concerns regarding food safety and phyto-sanitary measures.

Jordan's export market, for example, was impacted in 1991 when countries in the region restricted imports of fruits and vegetables irrigated wi
'/>"/>

Contact: Terry Collins
tc@tca.tc
416-538-8712
United Nations University
Source:Eurekalert

Page: 1 2 3 4 5 6 7 8 9

Related biology news :

1. Study finds surprising benefits about diary cow inflammation
2. Deserts greening from rising CO2
3. In subglacial lake, surprising life goes on
4. New study predicts rising irrigation costs, reduced yields for US corn
5. A surprising new function for small RNAs in evolution
6. Surprising findings on hydrogen production in green algae
7. Scientists find surprising new influence on cancer genes
8. Computer modeling reveals how surprisingly potent hepatitis C drug works
9. New look at cell membrane reveals surprising organization
10. Climate changes effects on temperate rain forests surprisingly complex
11. Surprising teaching tool in K-12 science education -- Zebrafish research
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:4/17/2014)... NJ. April 16, 2014. Kessler Foundation has been ... million from the Department of Defense Spinal Cord ... principal investigator for the randomized, double-blinded, controlled, multi-site ... bone and muscle strength after spinal cord injury. ... & Engineering Research at Kessler Foundation. Two additional ...
(Date:4/17/2014)... births, Down syndrome - or trisomy 21 - is ... results from a chromosomal abnormality where cells of affected ... of the human genome). A study conducted by Stylianos ... Medicine and Development at the University of Geneva (UNIGE) ... light on how the extra chromosome 21 upsets the ...
(Date:4/17/2014)... ago, Katia Silvera , a postdoctoral scholar at the ... field trip in a mountainous area in central Panama when ... , Unable to identify it, they contacted German Carnevali, a ... be an unnamed species. So Carnevali recently named it after ... genus name, comprising about 40 species in the world. ...
Breaking Biology News(10 mins):Kessler Foundation awarded Department of Defense grant for spinal cord injury research 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 3Orchid named after UC Riverside researcher 2Orchid named after UC Riverside researcher 3
... 2013) The Algae Biomass Organization (ABO), the trade ... of "Industrial Algae Measurements, Version 6.0" (IAM 6.0), ... by the organization for measuring and comparing algae ... new technologies to create fuels, feeds, nutritional supplements, ...
... this Moderate Resolution Imaging Spectroradiometer (MODIS) satellite image collected on ... Terra satellite and actively burning areas, detected by MODIS,s thermal ... is banned in Indonesia, but that does not always stop ... unusual dry spell in the area (this is usually the ...
... influence actual heart health, according to new research. A study ... ways in which your spouse is supportive and how ... on your overall cardiovascular health. The findings reveal that ... other as ambivalent that is, sometimes helpful and sometimes ...
Cached Biology News:ABO updates standards for measuring algae industry operations 2ABO updates standards for measuring algae industry operations 3ABO updates standards for measuring algae industry operations 4Heart disease risk linked with spouses' social support 2
(Date:1/15/2014)... DTS Language Services, Inc . is ... for Life Science organizations who need document translations. Clients ... of their documents in advance with a selection of nearly ... translations, often a critical factor in clinical and scientific fields, ...
(Date:1/14/2014)... Doylestown, PA (PRWEB) January 14, 2014 Date: ... p.m. , Location: Warrington Country Club, 1360 Almshouse Road, Warrington, ... only national nonprofit organization solely dedicated to finding a cure ... those affected worldwide, will host its annual Crystal Ball on ...
(Date:1/14/2014)... (PRWEB) January 14, 2014 EquitiesIQ, a ... Inc. (OTCQB: ALQA). Alliqua is an emerging biomedical company ... the wound care market. , Free report download: ... with a seasoned management team and Board, which launched ...
(Date:1/14/2014)... Jan. 14, 2014  RXi Pharmaceuticals Corporation (OTCQX: RXII), ... commercializing innovative therapies addressing major unmet medical needs ... the Notice of Allowance from the United States ... RNAi compounds (sd-rxRNA®), for the treatment of fibrosis. ...
Breaking Biology Technology:DTS Improves Efficiency for Life Science Document Translations 2Hepatitis B Foundation to Host Annual Crystal Ball Gala 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 2RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 3
... CARY, N.C., May 19, 2011 ... its flexible 100% web-based Life Science Study Management ... successfully used globally by Leading European and USA ... eStudy,s on-line study design, management, communication, data collection ...
... CLARA, Calif., May 19, 2011 The 2012 federal ... National Nanotechnology Initiative (NNI), a federal interagency research and ... manipulation of matter at the nanoscale—a measurement of particles ... meter) in size.  While nanoscale materials are found in ...
... Inc., a Massachusetts-based biopharmaceutical company, announced today that it ... Administration on a Special Protocol Assessment (SPA) for a ... agent for patients with newly diagnosed prostate cancer. The ... with definitive results expected by 2015. The randomized study ...
Cached Biology Technology:Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 2Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 3Environmental Training Center Prepares Companies to Handle Nanotechnology Environmental and Human Safety Impacts 2Advantagene Announces SPA Agreement With FDA to Launch Phase 3 Trial for Novel Vaccine Aimed at Preventing Prostate Cancer Recurrence 2
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products: