Navigation Links
UK scientists come together to help feed the 7 billion
Date:10/27/2011

ing well. It covers a wide range of matric potentials, does not need maintenance, is robust and does not fail when the soil becomes very dry. When water is in contact with solid particles (e.g. clay or sand particles within soil), adhesive intermolecular forces between the water and the solid can be large and important. The forces promote surface tension and the formation of menisci within the solid matrix. Force is then required to break these menisci.


'/>"/>
Contact: Sarah Hoyle
s.hoyle@exeter.ac.uk
44-013-927-22062
University of Exeter
Source:Eurekalert

Page: 1 2 3 4 5

Related biology news :

1. Jefferson scientists deliver toxic genes to effectively kill pancreatic cancer cells
2. Scientists identify novel inhibitor of human microRNA
3. Argonne scientists peer into heart of compound that may detect chemical, biological weapons
4. MU scientists go green with gold, distribute environmentally friendly nanoparticles
5. Scientists identify gene that may contribute to improved rice yield
6. Scientists discover why a mothers high-fat diet contributes to obesity in her children
7. MU scientists see how HIV matures into an infection
8. Earth scientists keep an eye on Texas
9. Thinking it through: Scientists call for policy to guide biofuels industry toward sustainability
10. Scientists identify a molecule that coordinates the movement of cells
11. Scientists Find new migratory patterns for Mediterranean and Western Atlantic bluefin tuna
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/10/2014)... Dec. 9, 2014  Wake Forest Baptist Medical Center today ... its School of Medicine. Funding for this $50 million ... that will be publicly launched next summer. ... the former 60 series R.J. Reynolds Tobacco Company complex, ... will begin immediately with plans to be ready to ...
(Date:12/5/2014)... -- Tute Genomics, a leader in cloud-based solutions for genome ... led by UK-based Eurovestech. Peak Ventures and a number ... "We are at a pivotal time in ... seeks new approaches for the diagnosis, treatment and prevention ... and CEO of Tute Genomics. "One of the main ...
(Date:11/21/2014)... 19, 2014  Earlier this year Donald Spector ... and one of the most prolific inventors in the ... transmitted from Smartphones to third party agencies. Spector envisioned ... one of the earliest known patents in this area. ... the military, child care, elder care and hospital applications. ...
Breaking Biology News(10 mins):Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 2Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 4
... been found in male cichlid fish that evolved to lure ... the females mouths. A study in the online open access ... egg-like markings on the fins of cichlid fishes and uncovers ... the success of the fishes, exotic oral mating behaviour. ...
... TORONTO, ON Researchers are closer to understanding why ... they look, behave, think, and fight off disease, despite ... Innovative research from the University of Torontos ... new explanations for these glaring differences. In comparing brain ...
... The first State of the Carbon Cycle Report for North ... Science Program, finds the continents carbon budget increasingly overwhelmed by ... tons of carbon into the atmosphere each year, mostly as ... may remove up to half this amount, but these current ...
Cached Biology News:University of Toronto finds humans and chimps differ at level of gene splicing 2First-ever 'State of the Carbon Cycle Report' finds troubling imbalance 2
(Date:12/19/2014)... N.Y. , Dec. 18, 2014 Egenix, Inc. ... has been elected Chairman of the Board, to succeed ... and CEO, but will continue as a member of the ... he has added to the company over almost twenty years, ... The Board of Directors has established a Search Committee ...
(Date:12/17/2014)... USA (PRWEB) December 16, 2014 ... manager at Philipps- Universität Marburg’s Department of Physics, ... photonics, in the newly released SPIE Women ... never be too shy to ask questions.” , ... technology, engineering, and mathematics) occupations ranging from university ...
(Date:12/17/2014)... Xeno Diagnostics has again received ... recent COLA inspection. Xeno has met all criteria ... accreditation organization. Accreditation is earned only by laboratories ... operations, demonstrate continued accuracy in the performance of ... survey. , While the Laboratory Excellence ...
(Date:12/17/2014)... Md. , Dec. 17, 2014 CASI ... company dedicated to the acquisition, development and commercialization of ... for the global market with a primary commercial focus ... it has been granted a Type C meeting with ... the meeting will be held in February 2015.  During ...
Breaking Biology Technology:Network, Multitask, Persevere: SPIE Women in Optics Planner Subjects Share from Experience 2Network, Multitask, Persevere: SPIE Women in Optics Planner Subjects Share from Experience 3Xeno Diagnostics Receives 3rd Award for Laboratory Excellence 2CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 2CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 3CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 4CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 5
... (1/25/11) -- Researchers from Boston College, MIT, Clemson and ... increase in the thermoelectric figure of merit of p-type ... in the American Chemical Society journal Nano Letters ... merit, used to measure a material,s relative thermoelectric performance, ...
... Inc. (Nasdaq: CEPH ) today announced positive ... (armodafinil) Tablets [C-IV] in patients experiencing excessive sleepiness associated ... their night shifts (i.e., 4:00 a.m. to 8:00 a.m.), ... significant difference in improvement in overall clinical condition related ...
... 2011 RxTrials, Inc., a network of premier clinical ... leading national clinical research consultant and education provider, has ... WBE certification was presented by the Women,s Business Enterprise ... site visit. The nationally recognized certification from ...
Cached Biology Technology:Nanotech milling produces dramatic increase in thermoelectric performance of bulk semiconductor 2Cephalon Announces Positive Topline Results From a Phase IV Study of NUVIGIL in Shift Work Disorder 2Cephalon Announces Positive Topline Results From a Phase IV Study of NUVIGIL in Shift Work Disorder 3Cephalon Announces Positive Topline Results From a Phase IV Study of NUVIGIL in Shift Work Disorder 4RxTrials Earns National Women-Owned Business Certification 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: