Navigation Links
UF researchers develop improved gene therapy agent
Date:5/19/2008

rs are creating additional new vectors based on this concept, with the goal of creating what Srivastava calls a perfect vector that lacks all seven phosphate-attracting tyrosines. They are also teaming with University of North Carolina researchers to test the vectors in dogs with hemophilia. If these studies are successful, the vector could be used in human gene therapy trials.

In addition to being more efficient, the new version of AAV could also prove to be more economical, Srivastava said. Current gene therapy trials are expensive because scientists must administer so much of the vector containing the therapeutic gene to see results. Using the new vector, scientists could potentially scale back to using as little as 100 billion particles instead of 10 trillion, Srivastava said.

I think this is a very promising step forward, said John Engelhardt, Ph.D., the director of the University of Iowa Center for Gene Therapy, who was not involved with the study but also plans to use the UF-developed vector in upcoming research. From a basic biological standpoint, this clarifies our understanding of how the virus acts in the cell. The more we understand, the better we are going to be at engineering viruses for use in humans.


'/>"/>

Contact: April Frawley Birdwell
afrawley@ufl.edu
352-273-5817
University of Florida
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. Researchers document rapid, dramatic reverse evolution in the threespine stickleback fish
2. Stowers Institute researchers identify gene linked to vertebral defects in patient populations
3. Researchers discover architecture for fundamental processes of life
4. ASU researchers synthesize molecule with self-control
5. Researchers uncover mechanism of action of antibiotic able to reduce neuronal cell death in brain
6. Berkeley researchers identify photosynthetic dimmer switch
7. Magnet Lab researchers make observing cell functions easier
8. Researchers find way to make tumor cells easier to destroy
9. UC Davis stem researchers demonstrate safety of gene therapy using adult stem cells
10. Researchers report the cloning of a key group of human genes, the protein kinases
11. UT researchers find link between advertising and increased tobacco use among Indias youth
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/10/2014)... NEW YORK , Dec. 8, 2014 You,ve ... online banking account but can,t remember your password, site key ... birthday? Who was your first grade teacher? ... launches the app that will finally put an ... PINs – 1U TM . 1U leverages a ...
(Date:12/10/2014)... Forest Baptist Medical Center today announced plans for a ... Funding for this $50 million capital project is part ... launched next summer. The medical education ... R.J. Reynolds Tobacco Company complex, adjacent to 525@vine in ... plans to be ready to welcome medical students in ...
(Date:12/10/2014)... , Dec. 08, 2014 Research and Markets ... addition of the "Biometrics Market in Japan ... http://photos.prnewswire.com/prnh/20130307/600769 The ... such as rural banking and upgradation of the ... witnessed in the market. Besides the aforementioned projects, ...
Breaking Biology News(10 mins):The Password is Finally Dead: Launch of 1U Mobile App Eliminates Need for All Usernames and Passwords 2The Password is Finally Dead: Launch of 1U Mobile App Eliminates Need for All Usernames and Passwords 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 4Biometrics Market in Japan 2014-2018: Key Vendors are DDS, Fujitsu, Hitachi and NEC 2
... 28, 2008) Just three years after it was discovered, ... to the Wildlife Conservation Society, which recently published the first-ever ... "kipunji," the large, forest-dwelling primate hovers at 1,117 individuals, according ... journal Oryx . The population estimate was ...
... at Houston say they are the first to provide ... may be an autoimmune disease. Their research could provide ... Findings appear online in Nature Medicine on ... Xia, M.D., Ph.D., an assistant professor of biochemistry and ...
... to dangerously low levels in diseases such as anemia ... cells, doctors filter platelets from donated blood, but this ... and cause other side effects in patients who need ... have been trying to generate platelets from embryonic stem ...
Cached Biology News:Pre-eclampsia may be autoimmune disease 2Pre-eclampsia may be autoimmune disease 3
(Date:12/24/2014)... “Preparative & Process Chromatography Market by Instrument ... Buffers, Valves, Guages, Seals), Accessories, Services, End User ... 2019” provides a detailed overview of the major ... strategies impacting the preparative and process chromatography market ... revenue and share analysis. , Full Copy ...
(Date:12/24/2014)... Island, New York (PRWEB) December 23, 2014 ... and the Long Island Affiliate of ITRA Global, the national ... slow but steady recovery. This is evidenced by the ... the strong stock market. Low energy costs have held ... The only negative is the housing market remaining soft. ...
(Date:12/24/2014)... , Dec. 23, 2014 China ... the "Company"), a leading fully integrated plasma-based biopharmaceutical ... announced that its majority-owned subsidiary, Shandong Taibang Biological ... ("GMP") certification from the China Food and Drug ... production facility. As previously disclosed in the Company,s ...
(Date:12/24/2014)... PARIS and NEW YORK ... data from its open-label pilot study of mazindol in ... Design, Development and Therapy in December 2014 . ... of mazindol in children with attention deficit/hyperactivity disorder" ( ... 2014 Dec 1;8:2321-2332. eCollection 2014 ) ...
Breaking Biology Technology:Preparative and Process Chromatography Market is expected to reach $9 billion by 2019 - New Report by Marketsandmarkets 2Preparative and Process Chromatography Market is expected to reach $9 billion by 2019 - New Report by Marketsandmarkets 3Preparative and Process Chromatography Market is expected to reach $9 billion by 2019 - New Report by Marketsandmarkets 4ITRA Global Reports Long Island Is Out of Sync With The National Office Market 2ITRA Global Reports Long Island Is Out of Sync With The National Office Market 3China Biologic Receives GMP Certification for New Coagulation Factor Facility 2China Biologic Receives GMP Certification for New Coagulation Factor Facility 3Redefining ADHD: A New Approach & A Shift of Paradigm in ADHD Therapeutics 2Redefining ADHD: A New Approach & A Shift of Paradigm in ADHD Therapeutics 3
... Polytechnic Institute Professor James Jian-Qiang Lu was recognized ... toward the design and realization of 3-D integrated ... Department of Electrical, Computer, and Systems Engineering (ECSE) ... D. Ashman Achievement Award for 2010 from the ...
... Intarcia Therapeutics. Inc today announced that Kurt ... presenting at the Lazard Capital Markets 7th Annual ... Tuesday, November 16, 2010 at 1:40pm local time ... (Logo:   http://photos.prnewswire.com/prnh/20050301/SFTU126LOGO ) ...
... 11, 2010 StemCyte, Inc., one of the world,s ... is proud to announce that the Company has been ... Internal Revenue Service,s Qualifying Therapeutic Discovery Project (QTDP) program ... than 250 employees. The Patient Protection and ...
Cached Biology Technology:Rensselaer Polytechnic Institute professor James Lu garners award for research on 3-D computer chips 2Intarcia Therapeutics Executive Chairman, Kurt Graves to Present at Lazard Capital Markets 7th Annual Healthcare Conference 2StemCyte Awarded $488,950 for Advanced Therapeutic Applications of Umbilical Cord Blood Stem Cells from the Qualifying Therapeutic Discovery Project (QTDP) 2
Agarose II (Low Melt)...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
Biology Products: