Navigation Links
UCR entomologists to develop special bacteria to combat spread of mosquito-borne diseases
Date:6/14/2010

who works in Federici's lab as well as the lab of William Walton, a professor of entomology.

Wirth explained that adult female mosquito longevity is the primary factor influencing the risk for disease transmission.

"This is because females must take a blood meal from an infected host, lay eggs, and survive long enough to take a second blood meal in order to transmit the disease agent," she said. "If adult female longevity is reduced in survivors of larval exposure to bacterial insecticides, then these can reduce the overall numbers of mosquitoes as well as the rate of disease transmission."


'/>"/>

Contact: Iqbal Pittalwala
iqbal@ucr.edu
951-827-6050
University of California - Riverside
Source:Eurekalert  

Page: 1 2 3 4

Related biology news :

1. UC Riverside entomologists say biocontrol of insect pest in the Galapagos Islands is a major success
2. 3 UC Riverside entomologists honored by Entomological Society of America
3. Penn State entomologists seek fungus to blunt mosquitoes sense of smell
4. Entomologists play matchmakers for cerambycid beetles
5. Mass. General researchers develop functional, transplantable rat liver grafts
6. New system developed for early diagnosis of Alzheimers disease
7. Conference to discuss sensing technology developments and opportunities
8. New discovery could aid development of elusive bovine mastitis vaccine
9. Aquatic life declines at early stages of urban development
10. Military develops multi-purpose green decontaminants for terrorist attack sites
11. $400,000 NRC grant to develop nuclear engineering faculty at Clemson
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
UCR entomologists to develop special bacteria to combat spread of mosquito-borne diseases
(Date:4/17/2014)... NJ. April 16, 2014. Kessler Foundation has been ... million from the Department of Defense Spinal Cord ... principal investigator for the randomized, double-blinded, controlled, multi-site ... bone and muscle strength after spinal cord injury. ... & Engineering Research at Kessler Foundation. Two additional ...
(Date:4/17/2014)... births, Down syndrome - or trisomy 21 - is ... results from a chromosomal abnormality where cells of affected ... of the human genome). A study conducted by Stylianos ... Medicine and Development at the University of Geneva (UNIGE) ... light on how the extra chromosome 21 upsets the ...
(Date:4/17/2014)... ago, Katia Silvera , a postdoctoral scholar at the ... field trip in a mountainous area in central Panama when ... , Unable to identify it, they contacted German Carnevali, a ... be an unnamed species. So Carnevali recently named it after ... genus name, comprising about 40 species in the world. ...
Breaking Biology News(10 mins):Kessler Foundation awarded Department of Defense grant for spinal cord injury research 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 3Orchid named after UC Riverside researcher 2Orchid named after UC Riverside researcher 3
... 2013) The Algae Biomass Organization (ABO), the trade ... of "Industrial Algae Measurements, Version 6.0" (IAM 6.0), ... by the organization for measuring and comparing algae ... new technologies to create fuels, feeds, nutritional supplements, ...
... this Moderate Resolution Imaging Spectroradiometer (MODIS) satellite image collected on ... Terra satellite and actively burning areas, detected by MODIS,s thermal ... is banned in Indonesia, but that does not always stop ... unusual dry spell in the area (this is usually the ...
... influence actual heart health, according to new research. A study ... ways in which your spouse is supportive and how ... on your overall cardiovascular health. The findings reveal that ... other as ambivalent that is, sometimes helpful and sometimes ...
Cached Biology News:ABO updates standards for measuring algae industry operations 2ABO updates standards for measuring algae industry operations 3ABO updates standards for measuring algae industry operations 4Heart disease risk linked with spouses' social support 2
(Date:1/15/2014)... DTS Language Services, Inc . is ... for Life Science organizations who need document translations. Clients ... of their documents in advance with a selection of nearly ... translations, often a critical factor in clinical and scientific fields, ...
(Date:1/14/2014)... Doylestown, PA (PRWEB) January 14, 2014 Date: ... p.m. , Location: Warrington Country Club, 1360 Almshouse Road, Warrington, ... only national nonprofit organization solely dedicated to finding a cure ... those affected worldwide, will host its annual Crystal Ball on ...
(Date:1/14/2014)... (PRWEB) January 14, 2014 EquitiesIQ, a ... Inc. (OTCQB: ALQA). Alliqua is an emerging biomedical company ... the wound care market. , Free report download: ... with a seasoned management team and Board, which launched ...
(Date:1/14/2014)... Jan. 14, 2014  RXi Pharmaceuticals Corporation (OTCQX: RXII), ... commercializing innovative therapies addressing major unmet medical needs ... the Notice of Allowance from the United States ... RNAi compounds (sd-rxRNA®), for the treatment of fibrosis. ...
Breaking Biology Technology:DTS Improves Efficiency for Life Science Document Translations 2Hepatitis B Foundation to Host Annual Crystal Ball Gala 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 2RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 3
... CARY, N.C., May 19, 2011 ... its flexible 100% web-based Life Science Study Management ... successfully used globally by Leading European and USA ... eStudy,s on-line study design, management, communication, data collection ...
... CLARA, Calif., May 19, 2011 The 2012 federal ... National Nanotechnology Initiative (NNI), a federal interagency research and ... manipulation of matter at the nanoscale—a measurement of particles ... meter) in size.  While nanoscale materials are found in ...
... Inc., a Massachusetts-based biopharmaceutical company, announced today that it ... Administration on a Special Protocol Assessment (SPA) for a ... agent for patients with newly diagnosed prostate cancer. The ... with definitive results expected by 2015. The randomized study ...
Cached Biology Technology:Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 2Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 3Environmental Training Center Prepares Companies to Handle Nanotechnology Environmental and Human Safety Impacts 2Advantagene Announces SPA Agreement With FDA to Launch Phase 3 Trial for Novel Vaccine Aimed at Preventing Prostate Cancer Recurrence 2
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products: