Navigation Links
UCLA cancer researchers develop model that may help identify cancer stem cells
Date:6/16/2009

Researchers at UCLA's Jonsson Comprehensive Cancer Center, on a quest to find lung cancer stem cells, have developed a unique model to allow further investigation into the cells that many believe may be at the root of all lung cancers.

If researchers could find a way to isolate and grow lung cancer stem cells, they could study their biologic mechanisms and perhaps identify targets for new therapies, said Raj Batra, an associate professor of medicine and a Jonsson Cancer Center scientist.

"What this model allows us to do is test, in patient specimens, which markers indicate the presence of lung cancer stem cells," said Batra, senior author of the study. "Our ultimate goal is to define lung cancer and the cells that cause it so we can develop more effective therapies."

The study appears in the June issue of PLoS One, a peer-reviewed journal of the Public Library of Science.

Two competing theories of how cancer originates have been weighed by scientists for decades. In one theory, all the cells of a tumor are the same, with an equal capacity to divide and form new tumors. The other theory holds that only a few, select cells from a tumor have the ability to initiate a new tumor - the cancer stem cells. In the last decade, scientists have been able to isolate leukemia stem cells as well as brain and breast cancer stem cells. Many scientists believe that most, if not all, cancers will one day be traced back to these stem cells.

Only a small percentage of cells in a tumor are cancer stem cells, making them hard to find and even more difficult to target. Current cancer therapies are designed to target dividing cells, and the treatments do kill the majority of the cancer cells. But cancer stem cells can lay dormant and survive chemotherapy as well as the molecularly targeted treatments now being used. Because they're not actively dividing, they're invisible to conventional treatment methods.

At some point,
'/>"/>

Contact: Kim Irwin
kirwin@mednet.ucla.edu
310-206-2805
University of California - Los Angeles
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. Green tea boosts production of detox enzymes, rendering cancerous chemicals harmless
2. A study by the MUHC and McGill University opens a new door to understanding cancer
3. ESF EURYI award winner aims to stop cancer cells reading their own DNA
4. Protein chatter linked to cancer activation
5. Newly created cancer stem cells could aid breast cancer research
6. Western diet linked to increased risk of colon cancer recurrence
7. Obesity and lack of exercise could enhance the risk of pancreatic cancer
8. Low levels of key protein may indicate pancreatic cancer risk
9. Birth records hold pancreatic cancer clue
10. Many parents at-risk for cancer disclose genetic test results to children
11. A new radiation therapy treatment developed for head and neck cancer patients
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:5/7/2015)... Sweden , May 7, 2015 ... touch fingerprint sensors, FPC1022 and FPC1035, FPC,s smallest ... and FPC1035 are mainly considered for integration on ... size gives smartphone OEMs increased possibilities to integrate ... The decreased size also improves possibilities for module ...
(Date:5/5/2015)... NXT-ID, Inc. (NASDAQ: NXTD ) ("NXT-ID" or ... mobile commerce market, reminds investors and media that  Mr. ...  at CARTES SECURE CONNEXIONS AMERICA 2015, held in ... The three-day conference is organized into a series of nine ... Global Fraud: Where is the Trust in Cyberspace? ...
(Date:4/27/2015)... Apr. 27, 2015 NXT-ID, Inc. (NASDAQ: ... company focused on the growing mobile commerce market, announces ... pre-order customers the first week of May, 2015 and ... of May. Gino Pereira , ... for the company as Wocket® enters the consumer market. ...
Breaking Biology News(10 mins):FPC Introduces its Smallest Touch Fingerprint Sensors to Date 2NXT-ID, Inc.'s CTO, David Tunnell, Presents at CARTES SECURE CONNEXIONS AMERICA 2015 Today in Washington DC. 2NXT-ID, Inc.'s CTO, David Tunnell, Presents at CARTES SECURE CONNEXIONS AMERICA 2015 Today in Washington DC. 3Wocket, the Smartest Wallet You Will Ever Own, Announces Shipment to Pre-order Customers 2Wocket, the Smartest Wallet You Will Ever Own, Announces Shipment to Pre-order Customers 3
... change on the microbial communities of two important ecosystemsthe ... a University of Oklahoma research group has been awarded ... to Jizhong Zhou, OU professor of botany and microbiology ... results of these studies could potentially contribute to the ...
... Medical Research in Melbourne, Australia, has entered a ... to evaluate and potentially develop for research and ... The institute has a portfolio of more than ... facility for research into cancer, chronic inflammatory diseases ...
... scientists from Singapore led by the Genome Institute of ... Biology (IMCB), two biomedical research institutes of Singapore,s ... the most important genes in human embryonic stem cells ... cells work. Their research, published in top scientific journal ...
Cached Biology News:Biotech collaboration established to commercialize research reagents 2Singapore scientists first to perform genome-wide study of human stem cells 2
(Date:5/22/2015)... 2015 Charm Sciences, Inc. is ... Agriculture (USDA), Grain Inspection, Packers and Stockyards Administration ... Charm Sciences to monitor aflatoxin in grains utilizing ... ROSA FAST Aflatoxin Quantitative Test (solvent-based). , The ... uses Water Extraction Technology to extract aflatoxin from ...
(Date:5/21/2015)... MO (PRWEB) May 21, 2015 Seventh ... the safety and efficacy of pharmaceutical products and medical ... Maryland Heights, MO 63043, a 50,000 sq. ft. building ... location, to enable strategic growth. Facility renovations will begin ... the new space will occur in September. , ...
(Date:5/21/2015)... May 21, 2015 uBiome, the ... a partnership with PicnicHealth, a healthcare company that ... diagnosed with Inflammatory Bowel Disease (IBD) will receive ... complementary uBiome research kit. Both companies were funded ... , For more information on this partnership ...
(Date:5/21/2015)... Bridgewater, NJ (PRWEB) May 21, 2015 ... and a method for diagnostic or therapeutic imaging within ... the apparatus uses an endoscope having a low cost, ... original USPTO filing date was October 18, 2013 and ... The technology enables the physician to customize the ...
Breaking Biology Technology:USDA-GIPSA (FGIS) Awards 5 Year Contract for Aflatoxin Tests to Charm Sciences 2Seventh Wave Laboratories Purchases Building for Expansion, Upcoming Move 2Seventh Wave Laboratories Purchases Building for Expansion, Upcoming Move 3uBiome Partners with PicnicHealth 2uBiome Partners with PicnicHealth 3IpAuctions™ Presents The Worlds Smallest Disposable Illuminated Endoscope For Auction 2IpAuctions™ Presents The Worlds Smallest Disposable Illuminated Endoscope For Auction 3
... Created Role of Senior Vice President of ... Philip R. Licari to Step Down as Chief Operating Officer upon Closing ... ... ), the manufacturer of the NxStage System One (TM),portable kidney dialysis machine, today ...
... SAN CARLOS, Calif., Aug. 29 Nektar,Therapeutics (Nasdaq: ... Lingnau has been,appointed to serve on its board ... with over 35 years of experience in,corporate management, ... to Nektar extensive pharmaceutical development and,commercialization experience at ...
... Colo., Aug. 29 Pharmion Corporation,(Nasdaq: PHRM ... Drug Administration,(FDA) has granted Fast Track designation for ... Fast Track programs are designed to facilitate ... that are intended to treat serious or,life-threatening conditions ...
Cached Biology Technology:NxStage Medical Provides Update on Medisystems Acquisition 2NxStage Medical Provides Update on Medisystems Acquisition 3NxStage Medical Provides Update on Medisystems Acquisition 4NxStage Medical Provides Update on Medisystems Acquisition 5Nektar Therapeutics Appoints Lutz Lingnau as New Board Member 2Nektar Therapeutics Appoints Lutz Lingnau as New Board Member 3Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 2Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 3Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 4Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 5Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 6
...
... is an evolutionarily conserved form of cell ... The central component of this process ... caspases. These enzymes participate in a ... response to pro-apoptotic signals and result in ...
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Biology Products: