Navigation Links
Twentieth-century warming in Lake Tanganyika is unprecedented
Date:5/17/2010

Lake Tanganyika's surface waters are currently warmer than at any time in the previous 1,500 years, a University of Arizona researcher and his colleagues report online in Nature Geoscience.

The rise in temperature during the 20th century is driving a decline in the productivity of the lake, which hosts the second-largest inland fishery in Africa.

"People throughout south-central Africa depend on the fish from Lake Tanganyika as a crucial source of protein," said study co-author Andrew S. Cohen, a UA professor of geosciences. "This resource is likely threatened by the lake's unprecedented warming since the late 19th century and the associated loss of lake productivity."

This is the first detailed record of temperature and its impacts on a tropical African ecosystem that allows scientists to compare the last 100 years with the previous 1,400 years, Cohen said.

The team attributes the lake's increased temperature and the decreased productivity during the 20th century to human-caused global warming.

"We've got a global phenomenon driving something local that has a huge potential impact on the people that live in the region and on the animals that live in the lake," he said.

The annual catch of the Lake Tanganyika fishery is estimated at about 198,000 tons per year, more than 20 times greater than the U.S. commercial fishery in the Great Lakes, he said. The nations of Burundi, Tanzania, Zambia and the Democratic Republic of Congo border the lake, which is the longest lake in the world and the second deepest.

The surface waters of Lake Tanganyika are the most biologically productive part of the lake. For the 1,400 years before 1900, those waters were no warmer than 75.7 F (24.3 degrees C). Since 1900, the lake's surface waters warmed 3 degrees F, reaching 78.8 degrees F (26 degrees C) in 2003, the date of the researchers' last measurement.

The researchers used sediment cores from th
'/>"/>

Contact: Mari N. Jensen
mnjensen@email.arizona.edu
520-626-9635
University of Arizona
Source:Eurekalert  

Page: 1 2 3

Related biology news :

1. Brown geologists show unprecedented warming in Lake Tanganyika
2. NASA, Purdue study offers recipe for global warming-free industrial materials
3. CO2 effects on plants increases global warming
4. Study gives green light to plants role in global warming
5. Study gives green light to plants’ role in global warming
6. Microbes contribute less to climate warming
7. Soil microbes produce less atmospheric CO2 than expected with climate warming
8. Topography of mountains could complicate rates of global warming
9. New mathematical model helps biologists understand how coral dies in warming waters
10. Global warming threatens plant diversity
11. Global warming may hurt some poor populations, benefit others
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Twentieth-century warming in Lake Tanganyika is unprecedented
(Date:9/16/2014)... to make ethical choices such as buying clothing not ... fair-trade coffee, and bringing their own bags when they ... Journal of Consumer Research , ethical consumption is ... emotions about unethical practices into action. , "Advocates of ... and human costs of the products they choose, but ...
(Date:9/16/2014)... practically all vital functions in an organism. For ... particular substances and control immune system responses. Researchers ... function independently of each other, but instead form ... networks, you find many similarities with online social ... of Plant Systems Biology. "Some proteins are good ...
(Date:9/16/2014)... , Sept. 16, 2014  Cross Match Technologies, ... solutions, announced today the launch of its Verifier ... the identity of an individual using their secure ... Sentry rapidly reads credential documents with embedded biometric ... matching the biometric to a live scan of ...
Breaking Biology News(10 mins):Why are consumers willing to spend more money on ethical products? 2Good networkers make prime targets 2Cross Match Launches New Identity Management Handheld Solution 2
... Children's Hospital of Philadelphia leads a multi-center $6.7 million ... of Mental Health (NIMH) to explore a novel approach ... studies and clinical trials in adult patients, the new ... human immunodeficiency virus: sites on immune cells known as ...
... found Envisat's MERIS sensor can detect coral bleaching ... could potentially monitor impacted coral reefs worldwide on ... symbiotic algae living in symbiosis with living coral ... expelled. The whitening coral may die with subsequent ...
... what happens in cells is the work of machines that ... human and other genomes, researchers now have a nearly complete ... manual telling where all the pieces go. A new study ... to answer this question for some of the smallest and ...
Cached Biology News:Federal grant funds research on novel HIV therapy 2Federal grant funds research on novel HIV therapy 3Health of coral reefs detected from orbit 2Many needles, many haystacks 2
(Date:9/16/2014)... Valley, Arizona (PRWEB) September 16, 2014 ... that develops safe and effective products to treat ... the use of a proprietary SPACEā„¢ Technology Platform ... Officer and President will present at the White ... 2014 at the Hyatt Regency Phoenix. In ...
(Date:9/16/2014)... , Sept. 16, 2014  Ascendis Pharma ... TransCon technology to address significant unmet medical needs, ... Phase 2 pediatric study to evaluate once-weekly TransCon ... or GHD.  The full interim results will be ... GRS and IGF Society, being held October 15-18, ...
(Date:9/16/2014)... According to Jeff Howell, Partner of Nidea ... new development in Downtown Toronto is expanding at a ... 755 storeys of new development last week (including three ... dominating the Toronto skyline for the foreseeable future in ... for new development. , As the Toronto city council ...
(Date:9/15/2014)... GREENBELT, Md. , Sept. 15, 2014 /PRNewswire/ ... a leading innovator of scientific products and services ... government-wide One Acquisition Solution for Integrated Services (OASIS) ... Service (FAS). GST was selected to provide the ... in the Small Business (SB) category in Pool ...
Breaking Biology Technology:Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 2Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 2Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 4ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 2ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 3Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 2Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 3
... HUBBARD, Ohio, Sept. 24 /PRNewswire-Firstcall/ -- NanoLogix, Inc. ... an exhibitor and,participant in the "Energy from Biomass ... David L. Lawrence Convention,Center in Pittsburgh, Pennsylvania September ... NanoLogix booth at the Expo, with,Dana Allen, Bret ...
... Seasoned leader brings added expertise to Shire ... England, Sept. 24, Shire plc (LSE: SHP, ... company, announced today that Sylvie,Gregoire has been ... (HGT),business, effective immediately. Sylvie brings more than ...
... BioCryst,Pharmaceuticals, Inc. (Nasdaq: BCRX ) today ... Life Sciences Conference in New York. A live ... 2007 at 2:00 p.m. Eastern,Time may be accessed ... will be archived for seven days. (Logo: ...
Cached Biology Technology:NanoLogix Inc. to Present at EBW Expo & Conference 2007 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 3Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 4BioCryst to Present at UBS 2007 Global Life Sciences Conference 2BioCryst to Present at UBS 2007 Global Life Sciences Conference 3
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: