Navigation Links
Triple-negative breast cancer subtypes identified using microRNA
Date:2/7/2013

ular virology, immunology and medical genetics at Ohio State.

"Several of the deregulated microRNAs we found in the cancer samples are involved in chemo-resistance or radio-resistance. MicroRNA profiles can help us to improve and personalize therapies for individual patients," she says.

Triple-negative breast cancer accounts for about 15 percent of all breast cancers. It is characterized by cancer cells that lack estrogen, progesterone and HER2 receptors. For this reason, these tumors do not respond to hormone therapies or HER2-targeted treatments.

MicroRNAs help regulate the kind and amount of proteins that cells make. They do this by binding with messenger RNA (mRNA), molecular copies of genes that are translated into proteins. When microRNA is bound to an mRNA, the messenger molecule cannot be translated into a protein. Instead, it is either temporarily stored or destroyed.

This study investigated associations between microRNA expression levels, mRNA expression levels and overall survival and distant-disease-free survival in women with triple-negative breast cancer.

Shapiro, Huebner and their colleagues evaluated 59 normal, 165 tumor and 54 metastatic matched tissue samples, obtained through The Stefanie Spielman Fund for Breast Cancer Research at the OSUCCC James.

The researchers ran a complete microRNA profile and a cancer-focused panel of genes for each sample. They then generated microRNA signatures represented by certain prognostic microRNAs that, when deregulated, indicate odds of survival.

"This was a large cohort of triple-negative breast cancer cases and a major analysis effort that we believe makes this work extremely valuable," Huebner says.

To stratify the cancers, the researchers determined microRNA and mRNA expression profiles in tumor, adjacent-normal tissue and lymph-node metastatic tissue from 173 women with the triple-negative breast cancer.

"We identified microRNAs and m
'/>"/>

Contact: Darrell E. Ward
Darrell.Ward@osumc.edu
614-293-3737
Ohio State University Medical Center
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. TGen-US Oncology data guides treatment of metastatic triple-negative breast cancer patients
2. Quantum dots deliver Vitamin D to tumors for possible inflammatory breast cancer treatment
3. In breast cancer metastasis, researchers identify possible drug target
4. Vitamin D holds promise in battling a deadly breast cancer, Saint Louis University researchers say
5. Does your job increase your breast cancer risk?
6. Breast cancer drug could halt other tumors
7. UCLA researchers to study depression in breast cancer survivors
8. Scientists unravel resistance to breast cancer treatment
9. High levels of DDT in breast milk
10. Breast milk promotes a different gut flora growth than infant formulas
11. New method provides fast, accurate, low cost analysis of BRCA gene mutations in breast cancer
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/24/2014)... its launch in December 2014, the 1U™ app ... trying to remember their usernames and passwords through replacing the ... To assist people who have struggled to remember usernames and ... and focuses on redefining identity, announced today that it is ...
(Date:12/22/2014)... DUBLIN , Dec. 22, 2014 Research and ... the addition of the "The Global Watermarking ... http://photos.prnewswire.com/prnh/20130307/600769 ... global digital media watermarking and fingerprinting markets. Watermarking ...
(Date:12/19/2014)... , Dec. 18, 2014 Research and Markets ... "iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & ... http://photos.prnewswire.com/prnh/20130307/600769 ... introduced the fingerprint reading feature with the iPhone 5S. ...
Breaking Biology News(10 mins):1U Offers Best Solution to the Username / Password Dilemma: For FREE! 21U Offers Best Solution to the Username / Password Dilemma: For FREE! 3The Global Watermarking and Fingerprinting Markets 2iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & Sapphire - Technology Report 2
... in a group of heat-loving bacteria by researchers at ... light a fire under next-generation biofuel production. Scientists ... to break down complex plant material such as switchgrass ... make biofuels. Conventional processes involve the addition of commercially ...
... faded since the end of the Cold War, existing ... devastating global impacts. Researchers at the University of ... effects of a hypothetical nuclear war between India and ... in distant countries. The work, by Mutlu Ozdogan ...
... in our bodies. This process is driven by microtubule filaments ... so-called motor proteins in the cytosol can control their dynamics. ... of cell division. It is composed in large part of ... size, shape and mobility of a cell. In a new ...
Cached Biology News:BESC researchers tap into genetic reservoir of heat-loving bacteria 2War-related climate change would reduce substantially reduce crop yields 2
(Date:1/22/2015)... 2015 Protocol Networks brings independent technology ... of brand-neutral, independent consultants, Protocol Networks has recently announced ... over the years, his company has attracted several clients ... Plainfield, as well as others. With the success of ...
(Date:1/22/2015)... Pipette.com has added the Eppendorf ... portfolio of Eppendorf products. , The Eppendorf Centrifuge 5424/5424 ... 5424/5424 R and receive the following:, , ... or Eppendorf Reference 2 ,     3 Free ...
(Date:1/22/2015)... Madison, WI (PRWEB) January 22, 2015 Dr. ... at the 12th annual Scripps Natural Supplements Pre-Conference seminar on ... Supplements Conference is an annual continuing education conference for health ... 15th and included the topic of probiotics in health. Dr. ...
(Date:1/22/2015)... January 22, 2015 Selexis SA, a ... Research Cell Banks (RCBs) used for drug discovery to ... Banks will include Next-Generation Sequencing (NGS) data ... de-risks biologic manufacturing by ensuring the integrity of the ...
Breaking Biology Technology:Protocol Networks Brings Independent Technology Consulting to the Constitution State 2Eppendorf Announces Promotional Bundle Which Includes: Eppendorf Centrifuge 5424, 3-Pack of Pipettes, and Tips - Available Now at Pipette.com 2Selexis Generated Research Cell Banks Now Fully Sequenced Using Next-Generation Sequencing 2
... AUSTIN, Texas and TORONTO, Oct. 3 Two ... to integrate vibration,therapy into the stem cell harvesting ... company based in Austin,Texas, has signed an exclusive ... of Toronto, Ontario. The partnership,between the two companies ...
... ),AMDL, Inc. (Amex: ADL ), a leading vertically ... US, today announced that the,Company will present at the ... Tuesday, October 7, 2008 at 10:30 a.m. ET. AMDL,s ... Hotel in the Morosco Room., The Maxim Group ...
... Stock Exchange Symbol: MS, EDMONTON, Oct. 3 ... developer in the treatment of multiple sclerosis (MS), ... (DSMB) for the,Company,s U.S. pivotal phase III MAESTRO-03 ... MS has completed a safety analysis,and recommended that ...
Cached Biology Technology:New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 2New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 3AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 2AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 3BioMS Medical's phase III U.S. multiple sclerosis trial receives positive safety review from Data Safety Monitoring Board 2
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Biology Products: