Navigation Links
Tree seeds offer potential for sustainable biofuels
Date:1/9/2013

Tree seeds, rather than biomass or fuel crop plants, could represent an abundant source of renewable energy, according to research published in the International Journal of Automotive Technology and Management. The study suggests that seeds from the Indian mahua and sal trees have almost as good a thermal efficiency as biodiesel but would produce lower emissions of carbon monoxide, waste hydrocarbons and NOx (nitrogen oxides).

Sukumar Puhan of the GKM College of Engineering and Technology and colleagues N. Vedaraman and K.C. Velappan of the Central Leather Research Institute, in Chennai, India, explain how tree seeds represent a vast untapped biomass resource for the production of automotive fuels in India. The use of tree seed oils as a source could have several additional benefits over vegetable seed oils including lower viscosity and greater volatility, both of which would reduce injector fouling, carbon deposits and piston ring sticking, common issues with some biodiesel formulations.

The team points out that vast tonnages of seeds from the deciduous mahua (Madhuca indica) and semi-deciduous sal (Shorea robusta) trees are simply left to waste on the forest floor. The mahua kernel constitutes 70% of the seed and contains 50% oil, which can be extracted at levels of 34 to 37%. Sal can produce about 20% oil. The oil is chemically converted to biodiesel using the process of transesterification, which reacts the oily triglyceride content with alcohol using a catalyst. The team has now successfully tested this chemistry on seeds from the mahua and sal trees. They also demonstrated efficacy with neem seed, although suggest the economics of using this species are prohibitive because the tree has greater value for its wood and also has a much longer maturation period than mahua at 25 years.

It is estimated that there are 64 million hectares of wasteland across India including 15 million hectares of degraded, notified f
'/>"/>

Contact: Albert Ang
press@inderscience.com
Inderscience Publishers
Source:Eurekalert

Page: 1 2

Related biology news :

1. Bugs need symbiotic bacteria to exploit plant seeds
2. Gout study offers genetic insight into disease of kings
3. Transplanted genetically-modified adipose cells offer potential therapy for liver diseases
4. Unraveling the threads: Simplest cotton genome offers clues for fiber improvements
5. Study offers insights into role of muscle weakness in Down syndrome
6. Vaccine offers promise as post-surgery treatment for pancreatic cancer patients
7. CCNY landscape architect offers storm surge defense alternatives
8. Basketball teams offer insights into building strategic networks
9. Young gamers offer insight to teaching new physicians robotic surgery
10. Fire logs made from lawn clippings offer earth-friendly option
11. Study offers new tool for incorporating water impacts into policy decisions
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:10/16/2014)... war on the human body. Battles are won, ... pancreatic cancer, this stalemate—known as tumor dormancy—can last ... a phenomena that is poorly understood. , ... of Salvatore Torquato, a Professor of Chemistry at ... tumor dormancy and the switch to a malignant ...
(Date:10/16/2014)... and Washington land managers have a new synthesis of ... moist mixed-conifer (MMC) forests in the two states. ... in Eastern Oregon and Washington: A Synthesis of the ... a general technical report published by the U.S. Forest ... to a request from managers for a synthesis of ...
(Date:10/16/2014)... be cultivated efficiently, they are anything but sustainable: ... monoculture cultivation is becoming increasingly evident. Despite their ... and are regarded as the sole possibility of ... wrongfully, finds Bernhard Schmid, an ecology professor at ... form of agriculture and forestry. After all, a ...
Breaking Biology News(10 mins):Modeling tumor dormancy 2New report synthesizes best available science on management of moist mixed-conifer forests 2Plant communities produce greater yield than monocultures 2Plant communities produce greater yield than monocultures 3
... by biophysicist Stuart Lindsay from the Biodesign Institute ... reproducible single molecule negative differential resistor ?and in ... that provides a “roadmap?for designing single-molecule devices based ... 18 by Lindsay at the American Association for ...
... distinctive tissues, such as heart, bone, and brain. At ... arose from various sets of genes switched on inside ... lack a protein that permanently turns off neuronal genes ... it turns out that precursor nerve cells contain that ...
... Affymetrix Inc. (Nasdaq: AFFX), announced today the launch ... protocol developed in conjunction with PreAnalytiX -- a ... Prime Standard: QIA) and BD (Becton, Dickinson and ... Blood RNA System for use with Affymetrix GeneChip ...
Cached Biology News:Successful Test Of Single Molecule Switch Opens The Door To Biomolecular Electronics 2Successful Test Of Single Molecule Switch Opens The Door To Biomolecular Electronics 3Gene keeps neural cells on correct developmental path 2Gene keeps neural cells on correct developmental path 3Affymetrix Launches New Globin-Reduction Kits and Protocol Developed with PreAnalytiX 2Affymetrix Launches New Globin-Reduction Kits and Protocol Developed with PreAnalytiX 3
(Date:10/22/2014)... and HONG KONG , Oct. ... disease therapeutics enterprise, announced today that rare disease expert ... as vice president, research. Dr. McKew brings more than ... leadership positions at the National Institutes of Health, Wyeth ... by Wyeth). Dr. McKew will lead aTyr,s efforts to expand ...
(Date:10/20/2014)... 20, 2014 /PRNewswire/ - BIOREM Inc. (TSXV: BRM) ("Biorem" or "the ... Q3 orders to $5.8 million and provides a good start to ... North America and one in the ... projects at record levels," said Peter Bruijns , President & ... end of Q3 than they have been for any complete year ...
(Date:10/20/2014)... 20, 2014 Earle Martin ... announced today that Ellen Teplitzky, an experienced attorney ... the pharmaceutical industry, has joined the firm as ... legal services practice. NDA Partners provides legal ... and testimony, to top law firms and their ...
(Date:10/19/2014)... The Asia-Pacific Bromine Market report defines and segments ... forecast of revenue. , Browse through the TOC ... get an idea of the in-depth analysis provided. ... in the Asia-Pacific bromine market, and is supported ... http://www.micromarketmonitor.com/market/asia-pacific-bromine-6741503144.html , Bromine is a volatile and ...
Breaking Biology Technology:aTyr Pharma Appoints John C. McKew, Ph.D., as Vice President, Research 2aTyr Pharma Appoints John C. McKew, Ph.D., as Vice President, Research 3NDA Partners Appoints Ellen Teplitzky, JD as Director of its Legal Services Practice 2The Asia-Pacific Bromine Market is estimated to grow to $4,080.1 million by 2018 - New Report by MicroMarket Monitor 2The Asia-Pacific Bromine Market is estimated to grow to $4,080.1 million by 2018 - New Report by MicroMarket Monitor 3
... Crosse, Wis. - Firstlogic, Inc ., a ... Crate and Barrel housewares retailer has deployed ... in its new customer management system initiative. , ,The ... quality in all aspects of its sales and communications ...
... calls to run government institutions as a business, with ... shareholders: taxpayers. Now schools are facing similar scrutiny. The ... Act have expanded the federal regulations with which schools ... also demanding more budget accountability at a time when ...
... Gov Jim Doyle on Thursday announced that three Wisconsin ... the Department of Commerce Technology Assistance Grant (TAG) and ... as follows: , , Functional Biosciences, Inc. ... provide DNA sequencing. It will receive a $250,000 TVF ...
Cached Biology Technology:Looking to software to manage the business of education 2Looking to software to manage the business of education 3Looking to software to manage the business of education 4
Mouse monoclonal antibody raised against a full length recombinant SLC25A11. NCBI Entrez Gene ID = SLC25A11...
Mouse polyclonal antibody raised against a partial recombinant SYT4. NCBI Entrez Gene ID = 6860...
Agarose II (Low Melt)...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
Biology Products: