Navigation Links
Think healthy, eat healthy: Caltech scientists show link between attention and self-control
Date:7/27/2011

assigns a value to a particular food.

The new study goes a step further, showing that there seem to be ways to help kickstart the dlPFC through the use of what Hare calls "external cues" that allow us to exhibit more self-control than we might have otherwise.

The researchers came to their conclusions based on data from a brain-imaging experiment conducted with 33 adult volunteers, none of whom were following a specific diet or trying to lose weight for any reason. Each of the volunteers was shown 180 different food itemsfrom chips and candy bars to apples and broccolithrough a set of video goggles while in a functional magnetic resonance imaging (fMRI) machine.

The hungry subjectsthey were asked to fast for at least three hours prior to the experimentwere given up to three seconds to respond to each picture with a decision about whether or not they'd want to eat the food shown after the experiment was over. They could either give the food a "strong no," a "no," a "yes," or a "strong yes." Once all of the images had been flipped through, a single food image was chosen at random; if the volunteer had said "yes" or "strong yes" to the idea of eating that food, he or she was served that item.

"Because only one random trial was selected to 'count,'" says Rangel, "the optimal strategy for subjects is to treat each decision as if it were the only one."

Simple, right? But here's the catch: before every 10 food choices, an instruction would come on the screen for five seconds telling the subjects either to "consider the healthiness," "consider the tastiness," or "make decisions naturally." This meant that of the 180 decisions, the subjects made 60 in each of the three "instruction conditions."

What this was meant to do, Rangel explains, is shift the subject's attention during the experiment and, potentially, shift the way in which they made decisions.

Afterwardoutside the scannerthe subjects were asked to rate th
'/>"/>

Contact: Deborah Williams-Hedges
debwms@caltech.edu
626-395-3227
California Institute of Technology
Source:Eurekalert  

Page: 1 2 3 4

Related biology news :

1. Rethinking extinction
2. Methane-powered laptops may be closer than you think
3. International think tank to examine Arctic issues
4. Falling in love more scientific than you think, according to Syracuse University professor
5. Think saturated fat contributes to heart disease? Think again
6. Magical thinking about islands is an illusion
7. When it comes to security, think natural
8. Children use space to think about time
9. Bacon or bagels? Higher fat at breakfast may be healthier than you think, says UAB research
10. Neuroscientist: Think twice about cutting music in schools
11. Queens researchers propose rethinking renewable energy strategy
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Think healthy, eat healthy: Caltech scientists show link between attention and self-control
(Date:6/17/2013)... bacteria, and algae, is a common component of sugar-free ... the medical field it,s approved by the FDA ... used during surgery as a substance that opens the ... , Now Profs. Ehud Gazit and Daniel Segal of ... and the Sagol School of Neuroscience, along with their ...
(Date:6/17/2013)... Ore. Amphibian populations are declining worldwide and a ... spread by bullfrogs, but a two-year study shows they ... that bullfrogs are a tolerant carrier host that just ... from eggs in controlled experimental conditions, they found at ... , also called Bd or a chytrid fungus, can ...
(Date:6/16/2013)... were fed a high-fat diet and became obese were ... levels of body fat, a new Ohio University study ... offspring, despite their consumption of a low-fat diet, scientists ... Society in San Francisco, Calif. , "We,ve identified a ... of offspring dependent on the pre-conception diet of the ...
Breaking Biology News(10 mins):Artificial sweetener a potential treatment for Parkinson's disease 2Bullfrogs may help spread deadly amphibian fungus, but also die from it 2Obese male mice father offspring with higher levels of body fat 2
... Saturday 02 April 2011: Data presented at the ... novel antiviral compounds for the treatment of hepatitis ... by experts and specialists to ensure resistance is ... of HCV resistance in patients treated with NS3-protease, ...
... (NASDAQ: AWRE ), a leading supplier of technology ... that Edmund C. Reiter has resigned, effective April 1, 2011, ... board of the company citing personal reasons.   ... have been named co-CEOs and co-Presidents on an interim basis. ...
... huge demands on water resources around the globe. ... major contributor to the nation,s economy, 85% of ... sector. The excessive use of irrigation water has ... where rising demand has deteriorated groundwater resources, depleted ...
Cached Biology News:Data suggest liver experts should take care when prescribing novel antiviral HCV drugs 2Aware, Inc. Announces Resignation of Chief Executive Officer 2Aware, Inc. Announces Resignation of Chief Executive Officer 3Research on satellite imagery aims to advance sustainable agriculture 2
(Date:6/18/2013)... 2013) A million electric cars could be on roads ... the help of research by the United States Department of ... , Professor Zhongwei Chen is part of a team led ... materials to replace the expensive platinum catalysts in fuel cells. ... fuel cells in vehicles is the cost of the units. ...
(Date:6/18/2013)... York, NY (PRWEB) June 18, 2013 ... innovation and sustainability, the Consulate General of Switzerland in ... solar boat, Switzerland’s MS Tûranor PlanetSolar , to ... part of its DeepWater Expedition 2013 tour with scientists ... led by Capitain Gérard d’Aboville, runs exclusively on energy ...
(Date:6/18/2013)... The Regulatory Affairs Professionals Society ... in Asia—one in Singapore and one in Shanghai, China. ... Pan-Asia office , serving the Asia Pacific region, and ... within China. , The announcement comes just a few ... government agencies to develop and implement a new ...
(Date:6/18/2013)... The human skin is the largest organ, ... human body part. Similar to the liver, or heart, the ... repair and grow. Recent reports from the mankatofreepress.com explained how ... as important as other life supporting organs. The article suggests ... cell reproduction, increase the appearance of skin, and fight off ...
Breaking Biology Technology:US and Canadian researchers drive towards cheaper fuel cells for electric cars 2Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 2Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 3Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 4RAPS Opens Offices in Singapore and China 2RAPS Opens Offices in Singapore and China 3Natural Acne Remedies Through Diet, Probiotic Action Shares New Insight on What Foods May Help Lead to Clear Skin 2
... Cynosure, Inc.,(Nasdaq: CYNO ), a leading ... aesthetic treatment systems, today announced that the company,will ... call on Tuesday,February 12, 2008 at 9:00 a.m. ... Executive Officer Michael Davin and,Executive Vice President and ...
... Introduced at Informex 2008, REDWOOD CITY, Calif., ... and leading developer of clean manufacturing,processes, today introduced ... can be used by pharmaceutical companies to more,rapidly ... lead,candidates., The Codex(TM) MicroCyp Plate is being ...
... Phase 1 studies show sobetirome, a selective thyroid hormone ... ... versus placebo, ANN ARBOR, Mich., Jan. 29 QuatRx ... endocrine, metabolic and cardiovascular diseases, today,announced results from two Phase ...
Cached Biology Technology:Cynosure to Announce Fourth-Quarter and Full Year 2007 Financial Results on February 12 2Codexis Launches Codex(TM) MicroCyp Platform to Produce Drug Metabolites and Novel Lead Compounds 2Phase 1 Studies Show Promise of QuatRx's Novel Compound, Sobetirome, for Lowering LDL Cholesterol Levels 2Phase 1 Studies Show Promise of QuatRx's Novel Compound, Sobetirome, for Lowering LDL Cholesterol Levels 3
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: