Navigation Links
The American Society for Microbiology honors Catherine A. Blish
Date:8/11/2010

Catherine A. Blish, M.D., Ph.D., Acting Instructor in Medicine, University of Washington, and Associate, Human Biology Division, Fred Hutchinson Cancer Research Center, Seattle, has been chosen by the American Society for Microbiology (ASM) to receive a 2010 ICAAC Young Investigator Award for her outstanding work elucidating the role of neutralizing antibodies in HIV transmission. Sponsored by Merck, U.S. Human Health Division, this award recognizes an early career scientist for research excellence in microbiology and infectious diseases.

Dr. Blish earned her M.D. and Ph.D. from the University of Washington. After completing her residency in internal medicine, she entered the Infectious Diseases fellowship at the University of Washington and began studies of HIV at the Fred Hutchinson Cancer Research Center. She first characterized a panel of early HIV envelope variants that were transmitted heterosexually in Africa. These variants now form the basis of a panel of standard reagents for evaluating neutralizing potential of plasma samples. Dr. Blish has continued this work by evaluating immune correlates of HIV re-infection and co-infection. She demonstrated that even individuals with relatively broad neutralizing antibody responses could succumb to superinfection, or re-infection, with a second strain of HIV. Thus, preventing HIV infection by vaccination will likely require broader and more potent neutralizing antibody responses than those found in chronically HIV infected individuals. She is now extending this work to evaluate whether other aspects of the immune response correlate with protection from HIV re-infection.


'/>"/>

Contact: Garth Hogan
ghogan@asmusa.org
American Society for Microbiology
Source:Eurekalert

Page: 1

Related biology news :

1. News from the October 2008 Journal of the American Dietetic Association
2. American Chemical Societys Weekly PressPac -- Sept. 24, 2008
3. Nanotech and synbio: Americans dont know whats coming
4. American Chemical Societys Weekly PressPac
5. American College of Medical Genetics receives $13.5M NIH contract
6. The American Society of Human Genetics hosts 58th Annual Meeting in Philadelphia
7. American Chemical Society Weekly PressPac Oct. 15, 2008
8. Scientists map soils on an extinct American volcano
9. Indiana University research at American Public Health Association meeting
10. North American environmental commission launches trinational vaquita conservation plan
11. News from the November 2008 Journal of the American Dietetic Association
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:8/28/2014)... (Maximizing Access to Research Careers) Program has announced ... of America,s 27th Annual Mouse Molecular Genetics Conference ... Pacific Grove, California. These awards are meant ... and scientists from underrepresented groups into the mainstream ... the participation of young scientists at the Genetics ...
(Date:8/28/2014)... Advocate and Senior Staff Attorney at the Electronic Frontier ... of biometric and mobile commerce experts set to speak ... Tampa, Florida on September 15, ... Rahman, Director, Technology and Strategy at Samsung, and Philippe de ... this year,s event is Mobility at the Crossroads of ...
(Date:8/28/2014)... good examples of complex systems. Their infrastructure equipment ... for cooling, transport to supply fuel, and ICT ... the network chain is interconnected with a wider ... team of UK-based scientists has studied various aspects ... have been published in EPJ B by Gaihua ...
Breaking Biology News(10 mins):Biometrics UnPlugged Welcomes the Electronic Frontier Foundation's Jennifer Lynch to the Mobility at the Crossroads of Commerce and Privacy Summit 2Inter-dependent networks stress test 2
... and Rongchao Jin have successfully used NMR to ... could advance the development and use of the ... approach offers a significant advantage over routine methods ... whether the nanoparticles exist in a both right-handed ...
... School have made an important discovery about the mechanism ... our understanding of how proteins regulate appetite control and ... Head of Metabolic and Vascular Health at Warwick Medical ... 1A, (CPT1) has a switch which is thrown depending ...
... aconites are plants, widely cultivated for their beauty and ... natural group of 650-700 species ranging from Eurasia into ... mountains. The study was published in the open access ... sampled molecular phylogeny for this group has revealed that ...
Cached Biology News:Carnegie Mellon researchers use NMR to determine whether gold nanoparticles exhibit 'handedness' 2Carnegie Mellon researchers use NMR to determine whether gold nanoparticles exhibit 'handedness' 3
(Date:8/28/2014)... 2014 SPIE Fellow Glenn Boreman, Professor ... Science and Director of the Center for Optoelectronics and ... Charlotte, and co-founder and Chairman of the Board of ... 2015 Vice President of SPIE, the international society for ... announced recent election results at the Annual General Meeting ...
(Date:8/28/2014)... A new research platform uses a ... tiny structures undergoing stress and heating, an ... designs for microelectronics and batteries., This new ... about how heating and the surface stress ... Researchers have discussed the merits of surface-stress ...
(Date:8/28/2014)... BOSTON , Aug. 28, 2014  Next month, executives ... at three key industry events beginning with Patient-Centered Clinical ... Hotel in Boston , September 4-5. Patient ... , and Aaron Fleishman will share insights on ... how a variety of tactics – from media to mobile ...
(Date:8/28/2014)... Florida State University research team has led to a ... white light, and convert photon energy directly to mechanical ... , Biwu Ma, associate professor in the Department of ... Engineering, created the molecule in a lab about a ... creation has many other unique capabilities. , For example, ...
Breaking Biology Technology:Glenn Boreman, UNC Professor and Plasmonics Co-Founder, Elected to SPIE Presidential Chain 2New analytical technology reveals 'nanomechanical' surface traits 2New analytical technology reveals 'nanomechanical' surface traits 3BBK Worldwide Leads Sessions at Key September Events 2Novel 'butterfly' molecule could build new sensors, photoenergy conversion devices 2
... DIEGO, June 8 , , WHO: ... and panelists discussing life sciences and the business relationships between California ... , CALAsia is an international 2-day forum that will bring ... Asia Pacific region to identify, explore, and further trans-Pacific business endeavors. ...
... International, a leader in enabling and accelerating the global ... today announced a strategic drug co-development partnership with the ... of therapeutic areas and represents one of the first ... company and a Chinese university. , , HUYA ...
... June 8 CSL Limited (ASX: CSL) and Talecris Biotherapeutics, ... their merger agreement, announced on August 12, 2008, under which ... , , Dr. Brian McNamee, CEO and Managing Director ... Federal Trade Commission (FTC) resolved to block the transaction. ...
Cached Biology Technology:BIOCOM's Inaugural CALAsia Forum 'Bridging the Pacific' 2HUYA Bioscience Announces Strategic Collaboration With the Shenyang Pharmaceutical University 2HUYA Bioscience Announces Strategic Collaboration With the Shenyang Pharmaceutical University 3CSL Limited and Talecris Biotherapeutics Agree to Terminate Merger Agreement 2CSL Limited and Talecris Biotherapeutics Agree to Terminate Merger Agreement 3
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... raised against a partial recombinant NFKBIB. ... 145 a.a) partial recombinant protein with GST tag. ... Accession: BC015528 ... OMIM: 604495, GeneID: ...
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: