Navigation Links
Symposium: Implications for the future of personalize medicine
Date:5/12/2010

two-year study looked at how people who decided to take the test would interpret and use the results in making their own health care decisions in the future.

About 2,000 patients took part in the Multiplex Initiative. Of those, 266 agreed to do the free multiplex genetic testing which can detect common variants of genes that slightly alter the chances of acquiring particular diseases.

Researchers at Henry Ford, a major health provider in metropolitan Detroit, randomly selected individuals between the ages of 25 and 40 to participate in the study.

The term "multiplex" refers to performing multiple genetic tests using the same blood sample. The test used for the study was designed to yield information about 15 different genes that play roles in type 2 diabetes, coronary heart disease, high blood cholesterol, high blood pressure, osteoporosis, lung cancer, colorectal cancer, and malignant melanoma.

On average, those who get tested in the Multiplex Initiative received results indicating that they carry four to 10 risk versions of individual genes. However, having a risk version of one of the 15 genes on the multiplex genetic test does not mean that a person is certain to get the condition only that he or she might have a greater chance of developing the disorder. There are many things other than genetics that contribute to the risk of common diseases, including lifestyle factors such as diet, exercise, smoking, and sun exposure.

Once enrolled, participants were asked to review information online about the multiplex genetic test and to decide whether they were interested in taking the test. Those who agreed to testing met with a research educator, who provided more information about the risks and benefits of testing and obtained the patient's written consent.

Test results were mailed to participants. Trained research educators called the participants to help them interpret and understand their results. The stu
'/>"/>

Contact: Krista Hopson
khopson1@hfhs.org
313-874-7207
Henry Ford Health System
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. AAAS Symposium: Emerging threats to tropical, temperate and ocean ecosystems
2. NHGRI funds new Centers for Excellence in Ethical, Legal and Social Implications Research
3. Multiple species of bacteria may cause trachoma: Implications for treatment
4. Reflecting on the social implications of human genetics research -- past, present and future
5. Stopping unwanted cell death: Implications for drug discovery
6. Duckweed genome sequencing has global implications
7. New research on pre-eclampsia in mice may have important implications for humans
8. NSF funds multi-university center to study environmental implications of nanotechnology
9. Duke to lead new NSF, EPA center to study the environmental implications of nanotechnology
10. NSF and EPA establish 2 centers for environmental implications of nanotechnology
11. UNC study on properties of carbon nanotubes, water could have wide-ranging implications
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/4/2014)... about the way our bodies are assembled during early ... they are supposed to become a nerve or a ... correct place and alignment? Researchers at the University of ... a new study, UM researchers describe the signaling systems ... at the head-trunk region. Their discovery may have important ...
(Date:11/4/2014)... , November 4, 2014   ... market growth   Fuel3D , a developer ... a funding round totaling $6.4 million (£4 million). This funding ... secured earlier this year and paves the way for the ... The funding round was led by Chimera Partners ...
(Date:11/4/2014)... , Nov. 4, 2014   Neurotechnology ... today announced that the latest version of its ... the Ongoing MINEX evaluation organized by ... fingerprint algorithms using the INCITS 378 fingerprint standard ... requirement in public tenders in the ...
Breaking Biology News(10 mins):The inside story: How the brain and skull stay together 2Fuel3D Secures $6.4 Million in Expansion Funding 2Fuel3D Secures $6.4 Million in Expansion Funding 3Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 2Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 3
... 9, 2009 Even small errors made by cells during protein ... ways to uncover these mistakes and correct them. Though in ... alaninenature has been extra careful, developing not one, but two ... is used correctly. Now, scientists at The Scripps ...
... to celebrate New Year,s Eve, drug industry executives will likely ... companies who make top-selling drugs for heart disease, asthma, and ... of mounting market pressures and a global recession. A timely ... scheduled for the current issue of Chemical & Engineering ...
... The University of Alabama used worms to reel in information ... cellular mechanisms that may be exploited to treat epilepsy. In ... ( http://www.genetics.org ), the researchers explain how the transparent roundworm, ... that control the transport of a molecule (gamma-aminobutyric acid or ...
Cached Biology News:Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 2Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 3Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 4More than fish bait: Worms unlock secrets to new epilepsy treatments 2
(Date:11/24/2014)... -- Five American winners will receive the ... for Medical Sciences", in its 8 th term; ... , on 15 December 2014.      (Photo: ... Center which won the Hamdan Award for Volunteers in ... that aim to improve health and promote peace and ...
(Date:11/24/2014)... One of the most extensive, widely cited ... is now available to high school and junior college students ... the international society for optics and photonics , announced today ... Digital Library available to high schools for free and ... integral to all areas of life in today’s world,” said ...
(Date:11/24/2014)... , November 24, 2014 ... Workflow, honored for dynamic leadership skills, business acumen ... technical and medical information products and services, congratulates ... for Clinical Reference and Workflow, Elsevier Clinical Solutions, for ... Worth Watching ® Awards issue of Profiles ...
(Date:11/22/2014)... CannLabs, Inc. (OTCQB: CANL), ... scientific testing methodologies relating to cannabis, today announced that ... of credit from an existing stockholder of the Company. ... this commitment from one of our existing stockholders,” stated ... capital will help accelerate our planned expansions into the ...
Breaking Biology Technology:Five US Winners Among Recipients of Hamdan Medical Awards 2SPIE Digital Library Now Available to High Schools, Two-Year Colleges at No or Low Cost 2Elsevier Clinical Solutions' Diane Bartoli Featured In Profiles in Diversity Journal's 13th Annual Women Worth Watching Issue 2Elsevier Clinical Solutions' Diane Bartoli Featured In Profiles in Diversity Journal's 13th Annual Women Worth Watching Issue 3CannLabs Secures $750,000 Line Of Credit 2
... Laura G. Leff, Department of Biological Sciences, Kent State,University, Kent, Ohio , ... Introduction , Assessing bacterial genetic ... because of difficulties in culturing native bacteria and the large number , ... physiological , traits of most microbes are ...
... and Li Tian, PhD, Bio-Rad Laboratories, 2000 Alfred,Nobel Drive, Hercules, CA 94547 USA, ... The Benchmark Plus microplate reader is a new ... that offers superior convenience, accuracy, and flexibility. , ... , feature has been designed in Microplate ...
, , , , , , back to top...
Cached Biology Technology:Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 2Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 3Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 4Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 5Benchmark Plus Microplate Reader Scan Well Feature 2Benchmark Plus Microplate Reader Scan Well Feature 3
... Staining Solution stains proteins in polyacrylamide ... limit >= 8 ng of protein) ... and destaining processes can be performed ... gel (20 min), proteins can be ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Biology Products: