Navigation Links
Summit of osteoporosis experts from CIS countries issue 5-point call for action
Date:1/9/2013

hat osteoporosis has been recognized as a priority for health care systems in CIS countries.

New epidemiological study underway:

The governments of CIS and adjacent countries do not draw enough attention to the problem. Despite evidence that fractures resulting from osteoporosis pose a major public health burden, neither epidemiological nor health-economic studies that might encourage specialists to be engaged in prevention are being carried out.

In many countries there is still a complete lack of relevant statistics. That is why the Russian Association on Osteoporosis has initiated the multinational population-based study in the countries of the region "Epidemiological study of osteoporotic fractures in Eurasia (EVA)". The goal is to obtain the data on incidence of main osteoporotic fractures.

Summit participants sign Appeal requesting action:

Given the dire state of affairs, the participants of the Summit proposed that osteoporosis be recognized as a health priority at the state level, and that treatment and prevention strategies, as well as urgent surgical treatment for patients with hip fractures, be provided. An appeal with such proposals towards the governments and health ministries of CIS countries was signed by the summit participants presenting 10 countries.

The signed document calls for the following five measures to be taken:

  • Recognize osteoporosis as a socially important disease due to high incidence, socio-economic burden and medical consequences;

  • Organize the collection of official statistics on fragility fractures, including hip fractures;

  • Increase the proportion of patients with hip fractures who can get surgical care within the first days after the trauma this will reduce the high rate of mortality and disability;

  • Provide the population with widely available DXA and modern methods of treatment of osteoporosis, free of charge for pe
    '/>"/>

Contact: L. Misteli
info@iofbonehealth.org
41-229-940-100
International Osteoporosis Foundation
Source:Eurekalert

Page: 1 2 3 4 5

Related biology news :

1. Maya Angelou Center Brings International Women’s Health Summit to Winston-Salem, NC
2. 2012 American Chestnut Summit
3. Silicon Valley Energy Summit 2012
4. Validity CTO to Present Natural ID Solutions for Improving Mobile Risk Management and User Experience at NFC Solutions Summit 2012
5. IOF Asia-Pacific Meeting presents new research and advances in osteoporosis management
6. Launch of the EU large-scale integrating project BlueGenics to combat osteoporosis
7. Register now for the key osteoporosis meeting in the Asia-Pacific region
8. Dual action polyclonal antibody may offer more effective, safer protection against osteoporosis
9. Mechanisms for a beneficial effect of moderate alcohol consumption on osteoporosis in women
10. New review outlines screening strategies for osteoporosis in young adults
11. Progress in Osteoporosis re-launched with new design, now invites commentary
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/4/2014)... about the way our bodies are assembled during early ... they are supposed to become a nerve or a ... correct place and alignment? Researchers at the University of ... a new study, UM researchers describe the signaling systems ... at the head-trunk region. Their discovery may have important ...
(Date:11/4/2014)... , November 4, 2014   ... market growth   Fuel3D , a developer ... a funding round totaling $6.4 million (£4 million). This funding ... secured earlier this year and paves the way for the ... The funding round was led by Chimera Partners ...
(Date:11/4/2014)... , Nov. 4, 2014   Neurotechnology ... today announced that the latest version of its ... the Ongoing MINEX evaluation organized by ... fingerprint algorithms using the INCITS 378 fingerprint standard ... requirement in public tenders in the ...
Breaking Biology News(10 mins):The inside story: How the brain and skull stay together 2Fuel3D Secures $6.4 Million in Expansion Funding 2Fuel3D Secures $6.4 Million in Expansion Funding 3Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 2Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 3
... 9, 2009 Even small errors made by cells during protein ... ways to uncover these mistakes and correct them. Though in ... alaninenature has been extra careful, developing not one, but two ... is used correctly. Now, scientists at The Scripps ...
... to celebrate New Year,s Eve, drug industry executives will likely ... companies who make top-selling drugs for heart disease, asthma, and ... of mounting market pressures and a global recession. A timely ... scheduled for the current issue of Chemical & Engineering ...
... The University of Alabama used worms to reel in information ... cellular mechanisms that may be exploited to treat epilepsy. In ... ( http://www.genetics.org ), the researchers explain how the transparent roundworm, ... that control the transport of a molecule (gamma-aminobutyric acid or ...
Cached Biology News:Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 2Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 3Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 4More than fish bait: Worms unlock secrets to new epilepsy treatments 2
(Date:11/24/2014)... -- Five American winners will receive the ... for Medical Sciences", in its 8 th term; ... , on 15 December 2014.      (Photo: ... Center which won the Hamdan Award for Volunteers in ... that aim to improve health and promote peace and ...
(Date:11/24/2014)... One of the most extensive, widely cited ... is now available to high school and junior college students ... the international society for optics and photonics , announced today ... Digital Library available to high schools for free and ... integral to all areas of life in today’s world,” said ...
(Date:11/24/2014)... , November 24, 2014 ... Workflow, honored for dynamic leadership skills, business acumen ... technical and medical information products and services, congratulates ... for Clinical Reference and Workflow, Elsevier Clinical Solutions, for ... Worth Watching ® Awards issue of Profiles ...
(Date:11/22/2014)... CannLabs, Inc. (OTCQB: CANL), ... scientific testing methodologies relating to cannabis, today announced that ... of credit from an existing stockholder of the Company. ... this commitment from one of our existing stockholders,” stated ... capital will help accelerate our planned expansions into the ...
Breaking Biology Technology:Five US Winners Among Recipients of Hamdan Medical Awards 2SPIE Digital Library Now Available to High Schools, Two-Year Colleges at No or Low Cost 2Elsevier Clinical Solutions' Diane Bartoli Featured In Profiles in Diversity Journal's 13th Annual Women Worth Watching Issue 2Elsevier Clinical Solutions' Diane Bartoli Featured In Profiles in Diversity Journal's 13th Annual Women Worth Watching Issue 3CannLabs Secures $750,000 Line Of Credit 2
... Laura G. Leff, Department of Biological Sciences, Kent State,University, Kent, Ohio , ... Introduction , Assessing bacterial genetic ... because of difficulties in culturing native bacteria and the large number , ... physiological , traits of most microbes are ...
... and Li Tian, PhD, Bio-Rad Laboratories, 2000 Alfred,Nobel Drive, Hercules, CA 94547 USA, ... The Benchmark Plus microplate reader is a new ... that offers superior convenience, accuracy, and flexibility. , ... , feature has been designed in Microplate ...
, , , , , , back to top...
Cached Biology Technology:Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 2Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 3Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 4Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 5Benchmark Plus Microplate Reader Scan Well Feature 2Benchmark Plus Microplate Reader Scan Well Feature 3
... Staining Solution stains proteins in polyacrylamide ... limit >= 8 ng of protein) ... and destaining processes can be performed ... gel (20 min), proteins can be ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Biology Products: