Navigation Links
Study: How a high-fat diet and estrogen loss leads women to store more abdominal fat than men
Date:9/5/2012

fat for heat, meaning the fat in females was burned away.

Researchers also studied fat tissue from human surgery patients and found the same enzyme was present in human tissue, and its levels were markedly higher in cells extracted from the visceral fat tissue of obese women compared to cells from lean women.

Finally, the study suggested that estrogen suppresses the enzyme's activity, which might help explain why postmenopausal women with decreased estrogen in their bodies tend to accumulate fat in their bellies.

The research is published online in the journal Diabetes.

The hormonal effect seen in these mice relates at least in part to how the female body processes vitamin A, a nutrient that is converted into a variety of compounds. These include a molecule that supports the burning of fat for energy, as well as retinoic acid, the hormone in this study that leads to the formation of visceral fat. The scientists showed that a high-fat diet functions as a switching mechanism that breaks down the fat-burning molecule and leads to activation of the enzyme and production of retinoic acid, ending in the development of visceral fat.

A year ago, Ziouzenkova's lab identified the one of these enzymes that relates to fat accumulation: Aldehyde Dehydrogenase 1, or Aldh1a1. In the current study, she and colleagues conducted numerous experiments in mice to track the events that followed activation of this enzyme.

The researchers compared normal mice with genetically altered mice lacking the enzyme over almost a year of eating a high-fat diet. Male and female normal mice gained weight on the high-fat diet, as expected, though the females developed more visceral fat that surrounds the organs than did males, a trend also seen in humans as the result of eating excess fat. (In contrast, on a regular diet, men are more likely than women to form abdominal fat.) Both sexes of mice developed peripheral subcutaneous fat, which
'/>"/>

Contact: Ouliana Ziouzenkova
Ziouzenkova.1@osu.edu
614-292-5034
Ohio State University
Source:Eurekalert

Page: 1 2 3 4

Related biology news :

1. BYU study: Using a gun in bear encounters doesnt make you safer
2. 15-year study: When it comes to creating wetlands, Mother Nature is in charge
3. Study: Exercise can lead to female orgasm, sexual pleasure
4. U of I study: Lose body weight before gaining baby weight
5. Study: Men who do load-bearing exercise in early 20s may be shielded from osteoporosis
6. USF study: Common fungicide wreaks havoc on freshwater ecosystems
7. Army study: DNA vaccine and duck eggs protect against hantavirus disease
8. Study: In-patient, out-patient stroke rehab might benefit from yoga
9. Study: Seeking Arctic methane has serious implications for Florida coastline
10. Study: Seeping Arctic methane has serious implications for Florida coastline
11. Study: No-fat, low-fat dressings dont get most nutrients out of salads
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:3/20/2015)... , Mar. 20, 2015 Research and Markets ... addition of the "India Sensors Market Forecast ... The sensor market is projected to ... Consumer electronics, automotive, industrial and healthcare ... in the country. In addition, adoption of MEMS ...
(Date:3/19/2015)... Conn. , March 19, 2015  NXT-ID, Inc. (NASDAQ: ... authentication company focused on the growing mobile commerce market, announces ... in a news clip that aired this week on ... ) . In a segment "The Next Great ... wallet ,a new way to pay, and ,a really big ...
(Date:3/17/2015)...  MecklerMedia Corporation (OTCQX: MECK) announced its ... ever held in New York City ... 2015 at the Javits Convention Center. ... Acorn Product Development; Axis NJ; c-Link Systems; CoroWare; ... NewBotic Corporation; Neya Systems LLC; Reliabotics; RoboKind; RocketFarm ...
Breaking Biology News(10 mins):India Sensors Market Forecast and Opportunities 2020 - STMicroelectronics held the largest share in 2014 2India Sensors Market Forecast and Opportunities 2020 - STMicroelectronics held the largest share in 2014 3NXT-ID's Wocket Smart Wallet Featured on Fox News Segment, "The Next Great Thing" 2NXT-ID's Wocket Smart Wallet Featured on Fox News Segment, "The Next Great Thing" 3MecklerMedia's RoboUniverse New York Announces Sponsors and Exhibitors, May 11-13, 2015 2
... June 10, 2010The ongoing search for evidence of past or ... such as proteins in Martian soil, but their absence to ... happens to these carbon-based molecules is presented in an article ... Mary Ann Liebert, Inc. The article is available free online ...
... CLEMSON, S.C. With a new twist on an ... to store "waste" energy underground to cut heating and cooling ... Molz have received a $991,000 grant from the U.S. Department ... system that can be used as a model for energy ...
... Cornell University researchers recently stretched individual molecules and ... can be used as powerful new tools for nanoscale ... 11 issue of the journal Science, probes ... important when shrinking electronics to their ultimate small size ...
Cached Biology News:New model is proposed to explain absence of organic compounds on surface of Mars 2Clemson engineers to create model underground energy-storage facility 2Clemson engineers to create model underground energy-storage facility 3Stretching molecules yields new understanding of electricity 2
(Date:3/26/2015)... LANSING, Mich., March 26, 2015 Neogen Corporation ... income for the third quarter of fiscal 2015, which ... to the prior year,s $6,575,000. Earnings per share in ... year ago. Current year-to-date net income increased 17% over ... to $20,621,000, or $0.56 per share, for the same ...
(Date:3/26/2015)... 26, 2015 Ale Gicqueau, Founder and ... of Clinical Affairs at Align Technology, on “ Conducting ... upcoming ACRP 2015 Global Conference and Exhibition on April ... , During the poster presentation, Ale Gicqueau and ... running a Postmarket Registry, the requirements and resources to ...
(Date:3/25/2015)... TORONTO , March 25, 2015 /PRNewswire/ - SQI Diagnostics ... announced that, as a result of recent discussions with ... common shares of the Company, after dealing with certain ... and special meeting of shareholders on March 26, 2015 ... that the election of directors will take place when ...
(Date:3/25/2015)... Laboratory workers can turn to ... Balances to get best-performing features while still remaining ... from the trusted brand include: , Cole-Parmer ... efficiency by providing a large weighing surface for ... include parts counting, percent weighing, checkweighing, animal/dynamic weighing, ...
Breaking Biology Technology:Neogen reports 13% increase in net income 2Neogen reports 13% increase in net income 3Neogen reports 13% increase in net income 4Neogen reports 13% increase in net income 5Neogen reports 13% increase in net income 6Neogen reports 13% increase in net income 7Neogen reports 13% increase in net income 8Clinovo Presents at ACRP 2015 in Salt Lake City, Utah on April 25th-28th 2Clinovo Presents at ACRP 2015 in Salt Lake City, Utah on April 25th-28th 3SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 2SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 3SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 4SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 5New Economical Top-Loading and Analytical Symmetry Balances from Cole-Parmer 2
... , a biopharmaceutical company developing cancer therapies, has announced ... been selected for preclinical testing and human clinical trials. ... safety assessment, it would submit to the U.S. ... application in late 2007, with human clinical trials expected ...
... Milwaukee, Wis - Understanding our genetic makeup ... to the point where DNA testing services, including ... shaping their own health management. Patients, however, will ... knowledge because most healthcare facilities are not yet ...
... The drive to make healthcare information technology interoperable ... applications, and a medical information technology company headquartered ... TeraMedica is lending its expertise to developing ... for the healthcare industry. Specifically, the expertise of ...
Cached Biology Technology:Healthcare slow to adopt genetic advances 2Healthcare slow to adopt genetic advances 3TeraMedica embraces open source project 2
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: