Navigation Links
Stanford researchers say 'peak oil' concerns should ease
Date:7/10/2013

alternatives to conventional oil," said Millard-Ball. "That would hasten the onset of a demand-driven peak."

Impacts of alternatives

The new research, though encouraging, does not describe a transportation future free of worry. Instead, the researchers recommend a shift in attention to the various alternatives to conventional oil.

Policymakers should not rely on oil scarcity to constrain damage to the world's climate. The alternatives to conventional oil emit varying amounts of greenhouse gases, while large-scale production of biofuels could have a disruptive impact on food prices and on local ecosystems where the plants are grown.

"If you care about the environment, you should care about where we are getting these fuels, whether we use the oil sands or biofuels," said Brandt. "Our study is agnostic on what mix of oil substitutes emerges, but we do know that if we don't manage them well, there will be big consequences."

The study forecasts global oil demand through 2100 under a variety of scenarios for economic growth, population, efficiency gains and fuel substitution. Interested parties can use the study's model, inputting their own set of assumptions at http://pangea.stanford.edu/researchgroups/eao/research/oil-substitution-and-decline-conventional-oil.


'/>"/>

Contact: Mark Shwartz
mshwartz@stanford.edu
650-723-9296
Stanford University
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. Recovery of Hawaiian green sea turtles still short of historic levels, Stanford-led study suggests
2. Stanford engineers monitor heart health using paper-thin flexible skin
3. Stanford researchers map out an alternative energy future for New York
4. Stanfords Markus Covert wins Paul Allen Distinguished Investigator Award
5. Stanford scientists calculate the carbon footprint of grid-scale battery technologies
6. Stanford scientists help shed light on key component of Chinas pollution problem
7. UC Berkeley, UCSF and Stanford join forces to help commercialize university innovations
8. Stanford researchers develop tool for reading the minds of mice
9. Going negative: Stanford scientists explore new technologies that remove atmospheric CO2
10. Stanford scientist uncovers the reproductive workings of a harvester ant dynasty
11. Stanford researcher sheds new light on the mysteries of spider silk
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:8/20/2014)... LAKE CITY Researchers at Huntsman Cancer Institute (HCI) at ... forms of the gene that encodes BCR-ABL, the unregulated ... According to the American Cancer Society, nearly 6,000 new ... Drugs already in use, called tyrosine kinase inhibitors (TKIs), ... They do not cure CML but control it in ...
(Date:8/20/2014)... State University, the Wellcome Trust Sanger Institute and the ... Mycobacterium pinnipedii from skeletons found in Peru ... is a relative of the TB bacterium that affects ... These researchers assume that seals carried the pathogens from ... lions was unexpected" comments Sebastien Gagneux, from the Swiss ...
(Date:8/20/2014)... Bay Area Lyme Foundation, which aims to make Lyme ... new research published in an upcoming issue of the ... . The findings show that ticks that carry ... year, making the threat of Lyme disease year-round. The ... Public Health (CDPH) Vector-borne Disease Section and University of ...
Breaking Biology News(10 mins):Blueprint for next generation of chronic myeloid leukemia treatment 2Lyme disease risk is year-round in Northwest California, according to new study 2Lyme disease risk is year-round in Northwest California, according to new study 3
... Following an agreement between ESA, Krunichev Space Centre and ... and a secondary payload, the technology demonstrator Proba-2 satellite, ... new November launch date follows a rescheduling of the ... Moisture and Ocean Salinity (SMOS) satellite and the secondary ...
... heat shock protein 90 gets steroid receptors into shape ... to targeted therapies for hormone-driven cancers, such as breast ... of Georgia researchers say. "We are trying to ... conformation so they work," says Dr. Ahmed Chadli, biochemist ...
... In the fruit fly,s developing brain, stem cells called ... cell that has a different fate. But neuroblast growth can ... Researchers at Duke-NUS Graduate Medical School in Singapore ... a counterpart in mammals, that can apparently prevent brain tumors ...
Cached Biology News:SMOS and Proba-2 launch rescheduled for November 2Targeting helpers of heat shock proteins could help treat cancer, cardiovascular disease 2Tumor suppressor gene in flies may provide insights for human brain tumors 2
(Date:8/21/2014)... His Majesty Willem-Alexander, King of the Netherlands ... His Majesty Willem-Alexander, King of the Netherlands, has announced ... POET-DSM Advanced Biofuels’ Project LIBERTY cellulosic ethanol plant in ... will take part in the Grand Opening Ceremony to ... p.m. and tour the plant. POET-DSM is a joint ...
(Date:8/21/2014)... , Aug. 21, 2014  Decision Resources ... Brazil and Mexico ... uptake of several newly approved agents, the anticipated ... indication and the launch of emerging biologics will ... In particular, the emerging IL-5 inhibitors will introduce ...
(Date:8/21/2014)... -- China Cord Blood Corporation (NYSE: CO ) ... results for the first quarter of fiscal year 2015 ... the US.  The Company will host ... August 29, 2014 to discuss its financial performance and ... followed by a question and answer session.  Interested parties ...
(Date:8/21/2014)... 2014 Ontotext S4 , The ... Ontotext . Now the same enterprise hardened text ... and unstructured data is available to start-ups and mid-size ... technology. Organizations that do not have resources to evaluate ... use S4 since there is no need for on ...
Breaking Biology Technology:His Majesty Willem-Alexander, King of the Netherlands, to Attend Project LIBERTY opening 2His Majesty Willem-Alexander, King of the Netherlands, to Attend Project LIBERTY opening 3Asthma Agents Currently Face a Suboptimal Coverage Environment in Brazil and Mexico, and as the Treatment Armamentarium Expands, Competitiveness Will Further Intensify 2Asthma Agents Currently Face a Suboptimal Coverage Environment in Brazil and Mexico, and as the Treatment Armamentarium Expands, Competitiveness Will Further Intensify 3China Cord Blood Corporation to Report First Quarter of Fiscal 2015 Financial Results 2Ontotext Releases Text Mining & Semantic Technology Running in the Cloud – Welcome to “S4? 2Ontotext Releases Text Mining & Semantic Technology Running in the Cloud – Welcome to “S4? 3Ontotext Releases Text Mining & Semantic Technology Running in the Cloud – Welcome to “S4? 4
... Yingxia,International, Inc. (OTC Bulletin Board: CYXI) ("China Yingxia" ... and nutritional food industry,engaged in the development, manufacture ... raw cactus plants in the People,s,Republic of China ... Ren,Hu will present at the upcoming Roth China ...
... Wall St. Network,s 3-Minute,Press Show is a daily program ... with public company executives on their,company and most recent ... viewers with insight into a company,s,latest news, and its ... Shows air Monday through Friday at: http://tv.wallst.net/3-min-press/3-min-press.php ...
... device company focused on developing, and commercializing interventional ... call scheduled for Tuesday, November 4, 2008 at ... PAUL, Minn., Nov. 4 ,Replidyne, Inc. (Nasdaq: ... that they have entered into a definitive merger ...
Cached Biology Technology:China Yingxia to Present at Roth China Comes to Vegas Conference 2[video] Wall St. Network's 3-Minute Press Show Features Executive Interviews and Highlights Recent Press for the Following: GTHR, BHRT, AGO 2Replidyne and Cardiovascular Systems Sign Merger Agreement 2Replidyne and Cardiovascular Systems Sign Merger Agreement 3Replidyne and Cardiovascular Systems Sign Merger Agreement 4Replidyne and Cardiovascular Systems Sign Merger Agreement 5Replidyne and Cardiovascular Systems Sign Merger Agreement 6Replidyne and Cardiovascular Systems Sign Merger Agreement 7
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Rabbit polyclonal antibody to GluR2...
Biology Products: