Navigation Links
Springer to publish Symbiosis
Date:10/13/2009

As of October 2009, Springer will publish Symbiosis, the official journal of the International Symbiosis Society (ISS). The journal was previously published by Balaban International Science Services. Publication at Springer will begin with Volume 49, Issue 1.

Symbiosis publishes results of original research which contribute to the understanding of symbiotic interactions at the molecular, cellular and organismal levels. It provides infomation on this fundamental and ubiquitous aspect of life on earth, and is a forum for scientists undertaking research in this biological field, fostering interaction among them. The journal publishes original research papers, review articles, book reviews, meeting reports and a calendar of events. The editor-in-chief is Professor David Richardson of Saint Mary's University in Halifax, Nova Scotia, Canada.

David Richardson said, "The move to Springer opens an exciting new era. The recent 6th International Symbiosis Congress in Madison, Wisconsin, USA, demonstrated the key roles played by symbiosis on all plant and animal life, and in every ecosystem, whether natural or man-made. The results of the research will now be much more widely available as Symbiosis becomes available both in print and online."

Jacco Flipsen, Editorial Director in Life Sciences at Springer, said, "We are very pleased to add Symbiosis to our list of journals. The journal publishes articles in a growing area of research, and complements our other publications in life sciences. We are looking forward to working with the International Symbiosis Society to further develop the journal."

Through the journal Symbiosis, Springer aims to promote the interests of the International Symbiosis Society. Founded in 1997, the ISS is primarily involved with the promotion of research and education in the growing field of symbiosis. The Society also seeks to build ongoing and useful communicatio
'/>"/>

Contact: Joan Robinson
joan.robinson@springer.com
49-622-148-78130
Springer
Source:Eurekalert

Page: 1 2

Related biology news :

1. Springer increases publishing activities in South Korea
2. Springer will publish Journal of Coastal Conservation
3. Springer book wins Quality of Communication Award
4. Estuarine Research Federation chooses Springer as publishing partner
5. Springer and the New York Botanical Garden Press join forces to publish botanical journals
6. Springer founds new journal Air Quality, Atmosphere and Health
7. Springer launches Tropical Plant Biology
8. Humana Press journals now available on SpringerLink
9. Springer author Carlos M. Duarte awarded Spanish science prize
10. Springer expands publishing partnership with the Biomedical Engineering Society
11. Springer editor honored with top environmental prize
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/16/2014)... CRG researchers shed ... Journal of Cell Biology describes how Topo 2 disentangles ... At this very moment thousands of our body,s cells are ... body repairs damaged tissues and regenerates others like skin and ... during which the cell duplicates its genetic material and separates ...
(Date:9/16/2014)... , Sept. 16, 2014  Valencell, Inc., a leader ... as one of 18 "Showcase Companies" representing ... the annual CED Tech Venture Conference on September 16-17 ... Convention Center in Raleigh, North Carolina ... lead a discussion during the "Digital Health Spotlight Sector" ...
(Date:9/15/2014)... and gut microbes influence processes from digestion to disease ... most biodiverse terrestrial ecosystems on the planet, more is ... the tropics. Smithsonian scientists and colleagues working on Panama,s ... a single tree were home to more than 400 ... tree species contained more than 7,000 different kinds. , ...
Breaking Biology News(10 mins):Unraveling cell division 2Unraveling cell division 3Valencell, Inc. Selected as 'Showcase Company' at CED Tech Venture Conference 2014 2Smithsonian scientists discover tropical tree microbiome in Panama 2
... reefs build their structures by both producing and accumulating ... and continued vertical growth capacity of reefs. An international ... carbonate being added by Caribbean coral reefs is now ... in some habitats is as much as 70% lower. ...
... the climate began warming at the end of the last ... to a warmer climate. But how will forests adapt to ... Foundation has awarded a $1.5 million grant to Drs. Stephen ... from the University of Maryland Center for Environmental Science,s Appalachian ...
... technique have determined the precise configuration of humulones, substances ... That might not sound like a big deal ... reported in scientific literature in the last 40 years ... some types of cancer and other maladies. "Now ...
Cached Biology News:New evidence highlights threat to Caribbean coral reef growth 2New evidence highlights threat to Caribbean coral reef growth 3New study will predict how trees will adapt to rapid climate change 2Beer's bitter compounds could help brew new medicines 2
(Date:9/16/2014)... -- BCC Research reveals in its new ... the global market for stem cells is expected to ... five-year compound annual growth rate (CAGR) of 13.6%. The ... growth projections of $2.2 billion in 2014 to $3.9 ... Unlike other potential applications of bioscience, stem ...
(Date:9/15/2014)... drives classical phase transitionsthink solid, liquid, and ... the temperature drops. If phase transitions occur ... mechanics reigns, subtle fluctuations can dramatically transform ... U.S. Department of Energy,s Brookhaven National Laboratory ... frigid landscape of absolute zero to isolate ...
(Date:9/15/2014)... , Sept. 15, 2014 ... on revolutionizing the treatment of cancer through the ... cells, announced that, together with the Asbestos Disease ... Cancer Institute New South Wales (NSW) Premier,s Award ... four recipients are the hospitals that will be ...
(Date:9/15/2014)... a patient has sepsis, a life-threatening condition in which ... often too fast for antibiotics to help. A new ... a team at Harvard,s Wyss Institute for Biologically Inspired ... , "Even with the best current treatments, sepsis ... 30 percent of the time," said Mike Super, Ph.D., ...
Breaking Biology Technology:Global Market for Stem Cells to Reach $10.6 Billion in 2018; The Americas Growing at 13.9% CAGR 2Global Market for Stem Cells to Reach $10.6 Billion in 2018; The Americas Growing at 13.9% CAGR 3Elusive quantum transformations found near absolute zero 2Elusive quantum transformations found near absolute zero 3EnGeneIC Named a Recipient of the Cancer Institute NSW Premier's Award for Excellence in Translational Cancer Research 2EnGeneIC Named a Recipient of the Cancer Institute NSW Premier's Award for Excellence in Translational Cancer Research 3Blood-cleansing biospleen device developed for sepsis therapy 2Blood-cleansing biospleen device developed for sepsis therapy 3Blood-cleansing biospleen device developed for sepsis therapy 4
... ... , ... Ind. (Vocus) June 17, 2009 –- Pioneer Hi-Bred , a DuPont business, ... to bring additional corn and soybean products to growers in the marketplace. Under these ...
... 17 Campbell Alliance, the leading management consulting firm ... that it has appointed industry veterans Jon W. McGarity ... gentlemen will work directly with John Campbell, CEO of ... advise the firm,s emerging and midsize client companies. ...
... QC, June 17 /PRNewswire-FirstCall/ - BioSyntech, Inc. (TSX: ... regenerative medicine, today announced statistically significant results from ... month follow-up in the BST-CarGel(R) randomized clinical trial. ... quality due to BST-CarGel treatment was found during ...
Cached Biology Technology:Pioneer Hi-Bred and Beck's Hybrids Enter into Research and Distribution Agreements 2Pioneer Hi-Bred and Beck's Hybrids Enter into Research and Distribution Agreements 3Campbell Alliance Adds Industry Veterans Jon W. McGarity and David Lilley as Executive Vice Presidents 2Campbell Alliance Adds Industry Veterans Jon W. McGarity and David Lilley as Executive Vice Presidents 3Campbell Alliance Adds Industry Veterans Jon W. McGarity and David Lilley as Executive Vice Presidents 4BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 2BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 3BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 4BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 5
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: