Navigation Links
Society of Interventional Radiology: 38th Annual Scientific Meeting
Date:4/10/2013

FAIRFAX, Va.From miniature ice balls that can zap pain and lung tumors to an image-guided, minimally invasive method to shrink the prostate, physicians will present the latest research on cutting-edge treatments at the Society of Interventional Radiology's 38th Annual Scientific Meeting April 13󈝾 at the Ernest N. Morial Convention Center in New Orleans. The meeting is centered on the theme "IR Reaching Out" and delivers education, resources and outcome-based evidence to attendees from a broad range of diverse clinical interests and practice settings.

Listed below are several examples of research being presented at SIR 2013, illustrating why the meeting attracts a diverse group of experts, including community or university-based physicians, physician assistants and nurse practitioners, radiology assistants, nurses, technologists as well as hospital administrators and industry partners.

For Men
Nonsurgical treatment shrinks enlarged prostate
Men who suffer from enlarged prostatesprompting frequent nighttime trips to the bathroom may have a minimally invasive option to shrink the gland. According to early reports from the first prospective U.S. study, prostatic artery embolization (PAE) reduces blood flow to the prostate, shrinking it and significantly reducing symptoms.
Medical illustrations are available.

Body Reshaping
Sculpting beautiful bodies with lasers
Fat-melting lasers are not only safe and effective, they could replace the surgical "tummy tuck," suggests research on more than 2,000 women and men. The safe new treatment melts fat, which is then suctioned out of the body.

Freezing Treatment
Freezing out pain Chronic pain can be helped by freezing damaged nerves, suggests a study of a minimally invasive treatment called cryoneurolysis. The treatment could provide relief to the more than 15 million Americans who suffer from chronic nerve
'/>"/>

Contact: Ellen Acconcia
eacconcia@sirweb.org
703-460-5582
Society of Interventional Radiology
Source:Eurekalert

Page: 1 2

Related biology news :

1. Ag, big data, and traditional knowledge headline the Ecological Society of Americas 2013 Meeting
2. Genetics Society of Americas Genetics journal highlights for April 2013
3. The Scandinavian Plant Physiology Society and Wiley extend over 60 years of partnership
4. American Society for Microbiology to host 113th General Meeting in Denver
5. Program highlights from the upcoming meeting of the American Physiological Society
6. Genetics Society of Americas Genetics journal highlights for March 2013
7. February highlights from Ecological Society of America publications
8. Entomological Society of America launches science policy program
9. The Geological Society of America Journal Geology: Dynamic geoscience
10. New American Chemical Society video highlights 5 of chocolates sweet benefits
11. Society of Interventional Radiology: Time to rethink varicose veins
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/18/2014)... --  News Highlights: , ... Partners Data Lake, an agile data and analytics ... allow researcher and clinicians to explore and develop ... of patients , The Partners Data Lake ... Partners system, breaking down physical barriers for collaboration ...
(Date:11/15/2014)... -- While we may still be a few years away from ... to gain instant access to all that ailed his patients, ... tablets for monitoring and measuring our health are cropping up ... a tad Orwellian to some, but a new survey suggests ... opportunities into their healthcare regime. These are some ...
(Date:11/10/2014)... appearing on U.S. store shelves in early 2010, and ... The small packets can be tossed into a washing ... or powder. The convenience, though, has come with risks ... at Nationwide Children,s Hospital found that from 2012 through ... children younger than 6 years of age swallowing, inhaling, ...
Breaking Biology News(10 mins):Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 2Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 3Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 4Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 5Americans May Be Ready for a Brave New World of Healthcare 2Americans May Be Ready for a Brave New World of Healthcare 3Americans May Be Ready for a Brave New World of Healthcare 4Study finds laundry detergent pods, serious poisoning risk for children 2
... For the first time, researchers have confirmed an association ... and abnormalities on brain MRI, according to a new ... The new study raises the possibility that a toxic ... body long after administration. Brain MRI exams ...
... Peterhans, a Roosevelt University professor and adjunct curator at ... mammals in Africa, has announced the discovery of four ... of the Democratic Republic of Congo. , The mammals ... led by the Wildlife Conservation Society (WCS) and in ...
... of millions of Americans, there,s no such thing as the ... hear a constant ringing, buzzing, hissing, humming or other noise ... be debilitating and life-altering. Now, University of Michigan ... what is going on inside their unquiet brains. The ...
Cached Biology News:Contrast agent linked with brain abnormalities on MRI 2Chicago scientist involved in discovery of 4 new mammal species in Democratic Republic of Congo 2U-M tinnitus discovery opens door to possible new treatment avenues 2U-M tinnitus discovery opens door to possible new treatment avenues 3
(Date:11/26/2014)... (PRWEB) November 25, 2014 Miles Holder, ... joined the Graphel Carbon Products team as Sales/Marketing Manager. ... marketing, and customer service for the graphite industry. , ... to our team,” stated Dave Trinkley, VP of Market ... wide range of experience in the graphite industry, along ...
(Date:11/26/2014)... 2014 Theravalues Corporation est fier d,annoncer ... européen au salon Hi Europe 2014 (du 2 ... Curcumine la plus biodisponible actuellement sur ... à des ingrédients approuvés par les règlements européens. ... présent dans la racine de curcuma ( Curcuma ...
(Date:11/24/2014)... Nov. 24, 2014  IGI Laboratories, Inc. (NYSE MKT: ... specialty generic pharmaceutical company, today announced it has submitted ... U.S. Food and Drug Administration (FDA), which brings the ... seven, with eighteen submissions now pending at the FDA. ... CEO of the Company, commented, "Our team here at ...
(Date:11/24/2014)... , November 24, 2014   ... online on ScienceDirect   Elsevier , a ... services, is pleased to announce the launch of the latest ... Current Opinion in Food Science . ... will provide specialists with a new platform to keep up-to-date ...
Breaking Biology Technology:Miles Holder Joins Graphel Corporation as Sales/Marketing Manager 2La curcumine présentant la plus haute biodisponibilité bientôt en vente en Europe 2La curcumine présentant la plus haute biodisponibilité bientôt en vente en Europe 3IGI Laboratories, Inc. Announces ANDA Submission 2Elsevier Announces Launch of New Journal: Current Opinion in Food Science 2Elsevier Announces Launch of New Journal: Current Opinion in Food Science 3
... Aug. 25 Reportlinker.com announces that a new ... Protein Kinase Therapeutics in Oncology ... http://www.reportlinker.com/p0284973/Protein-Kinase-Therapeutics-in-Oncology---Where-to-Commercialize.html This report comprises defined ... protein kinase drugs (990 projects) within the portfolio ...
... KONG, Aug. 25 bioserie is first to market ... give earth-conscious Apple device owners the protection they demand ... production. bioserie,s unique use of the latest in bioplastics ... and the prevention of environmental toxic pollution once the ...
... meet three goals in the production of biofuels ... production and ecological sustainability. Syracuse University,s Radhakrishna Sureshkumar, ... in the L.C. Smith College of Engineering and ... Satvik Wani have uncovered a process that is ...
Cached Biology Technology:Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 2Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 3Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 4Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 5Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 6Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 7Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 8Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 9Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 10Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 11Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 12Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 13Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 14Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 15Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 16Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 17Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 18Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 19Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 20bioserie Introduces the World's First 'Made of Plants' iPhone 4 Cover 2SU research team uses nanobiotechnology-manipulated light particles to accelerate algae growth 2
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Mouse monoclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = QPCT...
Biology Products: