Navigation Links
Signs of reversal of Arctic cooling in some areas
Date:7/29/2010

This release is available in German.

Moscow/Stuttgart/ Halle(Saale). Parts of the Arctic have cooled clearly over the past century, but temperatures have been rising steeply since 1990 also there. This is the finding of a summer temperature reconstruction for the past 400 years produced on the base of tree rings from regions beyond the Arctic Circle. German and Russian researchers analysed tree growth using ring width of pine from Russia's Kola Peninsula and compared their findings with similar studies from other parts of the Arctic. For the past 400 years since AD 1600, the reconstructed summer temperature on Kola in the months of July and August has varied between 10.4C (1709) and 14.7C (1957), with a mean of 12.2C. Afterwards, after a cooling phase, a ongoing warming can be observed from 1990 onwards. Researchers from the Institute of Geography in Moscow, Hohenheim University and the Helmholtz Centre for Environmental Research (UFZ) report in journal Arctic, Antarctic and Alpine Research: "The data indicate that solar activity may have been one of the major driving factors of summer temperatures, but this has been overlaid by other factors since 1990".

The researchers used for this study wood samples from a total of 69 Scots pines (Pinus sylvestris) from the Khibiny Mountains on the Kola Peninsula, situated between the Arctic Circle and the ocean port of Murmansk, not far from the Finnish border. The investigated region is a transition zone between Scandinavia, which is strongly affected by the gulf stream resp. North Atlantic Current, and the continental regions Eurasia. This makes the region particularly interesting for climatological studies.

Kola has a cold-temperate climate with long, moderately cold winters and cool, humid summers. In this part of the Arctic, the mean temperature fluctuates between -12C in January and +13C i
'/>"/>

Contact: Tilo Arnhold
presse@ufz.de
49-341-235-1635
Helmholtz Association of German Research Centres
Source:Eurekalert  

Page: 1 2 3 4

Related biology news :

1. bioMETRX, Inc. Signs Deal To Acquire Controlling Interest in Biometric Solutions, LLC
2. Unifying the animate and the inanimate designs of nature
3. University of Miami engineer designs stretchable electronics with a twist
4. Engineering technology pinpoints earliest signs of animal life
5. La Jolla Institute signs exclusive license agreement with Medimmune on major asthma discovery
6. UK robot sub searches for signs of melting 60 km into an Antarctic ice shelf cavity
7. Ben-Gurion University of the Negev signs collaborative contract with Bayer CropScience
8. WARF signs license agreement with Pfizer for human embryonic stem cells
9. Web-based program designs more efficient farm terrace layouts
10. University has grand designs to build a house of straw
11. New DNA test uses nanotechnology to find early signs of cancer
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Signs of reversal of Arctic cooling in some areas
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
(Date:12/19/2014)... 19, 2014  Roche (SIX: RO, ROG; OTCQX: RHHBY) ... (Bina), a privately held company based in ... provides a big data platform for centralized management ... Bina,s proprietary on-market Genomic Management Solution, Bina-GMS 1 ... perform fast and scalable analyses to maximize the ...
(Date:12/19/2014)... Today, TiFiber, Inc. announced ... and future company headquarters in Fort Smith, Arkansas ... that safely and effectively control dangerous microorganisms. Fort ... historic, strong support for manufacturing, but also due ... technology-based companies such as TiFiber. , In ...
(Date:12/19/2014)... 2014 In contrast to traditional LED ... various colors, Valoya uses proprietary LED technology to incorporate ... possible uniformity which is critical in low proximity installations. ... accuracy throughout its lifetime which is up to four ... , "The investment cost was clearly higher when compared ...
(Date:12/19/2014)...   ISN has released its third annual ... publication series. With data aggregated from over eight ... within its online contractor management platform, ISNetworld, this three-part ... (KPI) statistics. The Contractor ... is available in two industry specific volumes: Oil ...
Breaking Biology Technology:Roche acquires Bina Technologies and enters the genomic informatics market 2Roche acquires Bina Technologies and enters the genomic informatics market 3Technology Company TiFiber™ to Establish Production Facility in Fort Smith, Arkansas with Support from Local Investors 2Technology Company TiFiber™ to Establish Production Facility in Fort Smith, Arkansas with Support from Local Investors 3Technology Company TiFiber™ to Establish Production Facility in Fort Smith, Arkansas with Support from Local Investors 4ISN Releases Third Edition of US Contractor Health & Safety Performance Indicators Publication Series 2ISN Releases Third Edition of US Contractor Health & Safety Performance Indicators Publication Series 3
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: