Navigation Links
Sheep's mucosa shows the way to more effective medicine for severe neurological diseases
Date:9/25/2013

A big challenge in medical science is to get medicine into the brain when treating patients with neurological diseases. The brain will do everything to keep foreign substances out and therefore the brains of neurological patients fight a constant, daily battle to throw out the medicine prescribed to help the patients.

The problem is the so-called blood-brain barrier, which prevents the active substances in medicine from travelling from the blood into the brain.

"The barrier is created because there is extremely little space between the cells in the brain's capillar walls. Only very small molecules can enter through these openings and become active in the brain. And for the substances which finally get in, a new problem arises: The brain will do anything to throw them out again", explains assistant professor, Massimiliano di Cagno from in the Department of Physics, Chemistry and Pharmacy.

On this background science is looking for alternative pathways to the brain - and the nose is a candidate receiving much attention. From cocaine abusers it is well known that a substance can be absorbed through the nose and reach the brain extremely effective.

"It is very interesting to investigate if medical drugs can do the same", says di Cagno.

In recent years research has shown that it can be a very good idea to send medicine to the brain via the nose. The medicine can be sprayed into the nose and absorbed through the olfactory bulb, which is positioned at the front of the underside of the brain. Once the medicine passes the olfactory bulb there is direct access to the brain.

But there are many challenges to be solved before patients can be prescribed medication to be taken nasally.

"One of the biggest challenges is getting the olfactory bulb to absorb the substances aimed for the brain", explains di Cagno.

Together with Barbara Luppi from the University of Bologna in Italy he therefore investigated how to
'/>"/>

Contact: Birgitte Svennevig
birs@sdu.dk
45-65-50-29-36
University of Southern Denmark
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. AcelRx Pharmaceuticals Receives First U.S. Patent for Small-Volume Oral Transmucosal Dosage Forms
2. New study shows how ICU ventilation may trigger mental decline
3. New research shows how heart cells communicate to regulate heart activity
4. Fossil record shows crustaceans vulnerable as modern coral reefs decline
5. New muscular dystrophy treatment shows promise in early study led by Childrens National
6. Novelty of eco-friendly bamboo garments lures consumers -- if the price is right, Baylor study shows
7. Red cedar tree study shows that Clean Air Act is reducing pollution, improving forests
8. Human brains are hardwired for empathy, friendship, study shows
9. Research on which gender pays for dates shows change and resistance from convention
10. UEA research shows moderate exercise could be good for your tendons
11. Southerners are less trusting, but trust is a factor in environmental cooperation, study shows
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
(Date:12/19/2014)... Dec. 18, 2014 Egenix, Inc. is pleased to ... Chairman of the Board, to succeed Donald Fresne ; ... will continue as a member of the Board.  In recognition ... to the company over almost twenty years, the Board designated ... of Directors has established a Search Committee to find a ...
(Date:12/17/2014)... 2014 The Activated Carbon Manufacturing ... is why IBISWorld updated its original industry research report. ... from an intensified focus on environmental policy. Over the ... standards for power plants and a range of other ... Industry Analyst Sarah Kahn, “a range of downstream industrial ...
(Date:12/17/2014)... 17, 2014 Achim Noack has been ... Stoller Group. In this position, Noack will assist Jerry ... matters, develop marketing strategy and supervise global marketing management ... “Achim has tremendous knowledge and experience in the crop ... “His experience and innovative thinking will be a great ...
(Date:12/17/2014)... Dallas, Texas (PRWEB) December 17, 2014 ... research on Global Quartz Tubing industry. For an ... information, definition, classification, application, industry chain structure, industry ... domestic quartz tubing industry has witnessed ... through a number of acquisitions. This report mentions ...
Breaking Biology Technology:Activated Carbon Manufacturing in the US Industry Market Research Report Has Been Updated from IBISWorld 2Activated Carbon Manufacturing in the US Industry Market Research Report Has Been Updated from IBISWorld 3Achim Noack Joins Stoller Group as Global Vice President of Marketing and Administration 22020 Quartz Tubing Market: Global Development & Forecasts Analysis Now at DeepResearchReports.com 2
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: