Navigation Links
Shape-sifting: NIST categorizes bio scaffolds by characteristic cell shapes
Date:2/7/2014

Getting in the right shape might be just as important in a biology lab as a gym. Shape is thought to play an important role in the effectiveness of cells grown to repair or replace damaged tissue in the body. To help design new structures that enable cells to "shape up," researchers at the National Institute of Standards and Technology (NIST) have come up with a way to measure, and more importantly, classify, the shapes cells tend to take in different environments.*

With the notable exception of Flat Stanley, we all live, and are shaped by, a 3-dimensional world. Biologists have accepted that this dimensional outlook is just as important to growing cells. A key challenge in tissue engineeringthe engineering of living cells to grow into replacement or repair tissues such as bone, heart muscle, blood vessels or cartilageis creating 3-D scaffolds to support the cells as they grow and provide an appropriate environment so that they develop into viable tissue.**

This, says NIST materials scientist Carl Simon, has led to a large and rapidly expanding collection of possible 3D scaffolds, ranging from relatively simple gels made of collagen, the body's natural structural matrix, to structured or unstructured arrangements of polymer fibers, hydrogels and many more.

"What we're trying to measure," Simon explains, "is 'what is 3D in this context?' Presumably, a scaffold provides some sort of microenvironmenta niche that allows a cell to adopt the normal 3D morphology that it would have in the body. But you can't measure the niche because that's sort of an amorphous, ill-defined concept. So, we decided to measure cell shape and see how that changes, if it becomes more 3D in the scaffold."

The NIST team made painstaking measurements of individual cells in a variety of typical scaffolds using a confocal microscope, an instrument that can make highly detailed, 3-dimensional images of a target, albeit with very lengthy exposure times. Th
'/>"/>

Contact: Michael Baum
michael.baum@nist.gov
301-975-2763
National Institute of Standards and Technology (NIST)
Source:Eurekalert  

Page: 1 2

Related biology news :

1. Nanoscale scaffolds and stem cells show promise in cartilage repair
2. Slice, stack, and roll: A new way to build collagen scaffolds
3. 3-D biomimetic scaffolds support regeneration of complex tissues from stem cells
4. Female mice exposed to BPA by mothers show unexpected characteristics
5. Juniper essential oil characteristics determined
6. Unique new dataset CLIMBER: Climatic niche characteristics of the butterflies in Europe
7. Not a 1-way street: Evolution shapes environment of Connecticut lakes
8. Oh, my stars and hexagons! DNA code shapes gold nanoparticles
9. New geometries: Researchers create new shapes of artificial microcompartments
10. Epigenetics shapes fate of brain vs. brawn castes in carpenter ants
11. The genomes 3-D structure shapes how genes are expressed
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Shape-sifting: NIST categorizes bio scaffolds by characteristic cell shapes
(Date:4/17/2014)... NJ. April 16, 2014. Kessler Foundation has been ... million from the Department of Defense Spinal Cord ... principal investigator for the randomized, double-blinded, controlled, multi-site ... bone and muscle strength after spinal cord injury. ... & Engineering Research at Kessler Foundation. Two additional ...
(Date:4/17/2014)... births, Down syndrome - or trisomy 21 - is ... results from a chromosomal abnormality where cells of affected ... of the human genome). A study conducted by Stylianos ... Medicine and Development at the University of Geneva (UNIGE) ... light on how the extra chromosome 21 upsets the ...
(Date:4/17/2014)... ago, Katia Silvera , a postdoctoral scholar at the ... field trip in a mountainous area in central Panama when ... , Unable to identify it, they contacted German Carnevali, a ... be an unnamed species. So Carnevali recently named it after ... genus name, comprising about 40 species in the world. ...
Breaking Biology News(10 mins):Kessler Foundation awarded Department of Defense grant for spinal cord injury research 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 3Orchid named after UC Riverside researcher 2Orchid named after UC Riverside researcher 3
... 2013) The Algae Biomass Organization (ABO), the trade ... of "Industrial Algae Measurements, Version 6.0" (IAM 6.0), ... by the organization for measuring and comparing algae ... new technologies to create fuels, feeds, nutritional supplements, ...
... this Moderate Resolution Imaging Spectroradiometer (MODIS) satellite image collected on ... Terra satellite and actively burning areas, detected by MODIS,s thermal ... is banned in Indonesia, but that does not always stop ... unusual dry spell in the area (this is usually the ...
... influence actual heart health, according to new research. A study ... ways in which your spouse is supportive and how ... on your overall cardiovascular health. The findings reveal that ... other as ambivalent that is, sometimes helpful and sometimes ...
Cached Biology News:ABO updates standards for measuring algae industry operations 2ABO updates standards for measuring algae industry operations 3ABO updates standards for measuring algae industry operations 4Heart disease risk linked with spouses' social support 2
(Date:1/15/2014)... DTS Language Services, Inc . is ... for Life Science organizations who need document translations. Clients ... of their documents in advance with a selection of nearly ... translations, often a critical factor in clinical and scientific fields, ...
(Date:1/14/2014)... Doylestown, PA (PRWEB) January 14, 2014 Date: ... p.m. , Location: Warrington Country Club, 1360 Almshouse Road, Warrington, ... only national nonprofit organization solely dedicated to finding a cure ... those affected worldwide, will host its annual Crystal Ball on ...
(Date:1/14/2014)... (PRWEB) January 14, 2014 EquitiesIQ, a ... Inc. (OTCQB: ALQA). Alliqua is an emerging biomedical company ... the wound care market. , Free report download: ... with a seasoned management team and Board, which launched ...
(Date:1/14/2014)... Jan. 14, 2014  RXi Pharmaceuticals Corporation (OTCQX: RXII), ... commercializing innovative therapies addressing major unmet medical needs ... the Notice of Allowance from the United States ... RNAi compounds (sd-rxRNA®), for the treatment of fibrosis. ...
Breaking Biology Technology:DTS Improves Efficiency for Life Science Document Translations 2Hepatitis B Foundation to Host Annual Crystal Ball Gala 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 2RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 3
... CARY, N.C., May 19, 2011 ... its flexible 100% web-based Life Science Study Management ... successfully used globally by Leading European and USA ... eStudy,s on-line study design, management, communication, data collection ...
... CLARA, Calif., May 19, 2011 The 2012 federal ... National Nanotechnology Initiative (NNI), a federal interagency research and ... manipulation of matter at the nanoscale—a measurement of particles ... meter) in size.  While nanoscale materials are found in ...
... Inc., a Massachusetts-based biopharmaceutical company, announced today that it ... Administration on a Special Protocol Assessment (SPA) for a ... agent for patients with newly diagnosed prostate cancer. The ... with definitive results expected by 2015. The randomized study ...
Cached Biology Technology:Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 2Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 3Environmental Training Center Prepares Companies to Handle Nanotechnology Environmental and Human Safety Impacts 2Advantagene Announces SPA Agreement With FDA to Launch Phase 3 Trial for Novel Vaccine Aimed at Preventing Prostate Cancer Recurrence 2
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products: