Navigation Links
Scientists guide immune cells with light and microparticles
Date:11/16/2009

ed to manipulate chemical gradients."

The team used two different chemicals, one of which attracted the cells and another that repelled them, to demonstrate how they could direct the neutrophils into moving along a path, either toward or away from the microparticles. They could also examine how the cells responded when there were conflicting signals sent by several of the artificial bacteria.

Chemotaxis the migration of cells based on chemical signals in their environment plays an important role in a number of biological processes and diseases beyond the immune system. "Understanding how cells move in response to chemical stimuli can help us better understand how a single egg develops into a complex organism or how brain cells grow into a network of neurons in a growing embryo, or how cancer cells spread through the body," Kress said. "This technique could give biologists insight into the ways many different types of cells respond to environmental stimuli in a wide range of situations."


'/>"/>

Contact: Suzanne Taylor Muzzin
suzanne.taylormuzzin@yale.edu
203-432-8555
Yale University
Source:Eurekalert  

Page: 1 2

Related biology news :

1. Scientists put interactive flu tracking at publics fingertips
2. Singapore scientists join international study of 10,000 vertebrates genomes
3. Scientists are first to unlock the mystery of creating cultured pearls from the queen conch
4. UM scientists create fruit fly model to help unravel genetics of human diabetes
5. USU scientists report major advance in human antibody therapy against deadly Nipah virus
6. Scientists discover influenzas Achilles heel: Antioxidants
7. EPAs new green parking lot allows scientists to study permeable surfaces that may help the environment
8. Scientists are first to observe the global motions of an enzyme copying DNA
9. Boston University scientists first to see RNA network in live bacterial cells
10. Scientists create NICE solution to pneumonia vaccine testing problems
11. Scientists of the UGR obtain a bioinsecticide to control the Mediterranean fruit fly
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Scientists guide immune cells with light and microparticles
(Date:12/10/2014)... Dec. 9, 2014  Wake Forest Baptist Medical Center today ... its School of Medicine. Funding for this $50 million ... that will be publicly launched next summer. ... the former 60 series R.J. Reynolds Tobacco Company complex, ... will begin immediately with plans to be ready to ...
(Date:12/5/2014)... -- Tute Genomics, a leader in cloud-based solutions for genome ... led by UK-based Eurovestech. Peak Ventures and a number ... "We are at a pivotal time in ... seeks new approaches for the diagnosis, treatment and prevention ... and CEO of Tute Genomics. "One of the main ...
(Date:11/21/2014)... 19, 2014  Earlier this year Donald Spector ... and one of the most prolific inventors in the ... transmitted from Smartphones to third party agencies. Spector envisioned ... one of the earliest known patents in this area. ... the military, child care, elder care and hospital applications. ...
Breaking Biology News(10 mins):Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 2Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 4
... been found in male cichlid fish that evolved to lure ... the females mouths. A study in the online open access ... egg-like markings on the fins of cichlid fishes and uncovers ... the success of the fishes, exotic oral mating behaviour. ...
... TORONTO, ON Researchers are closer to understanding why ... they look, behave, think, and fight off disease, despite ... Innovative research from the University of Torontos ... new explanations for these glaring differences. In comparing brain ...
... The first State of the Carbon Cycle Report for North ... Science Program, finds the continents carbon budget increasingly overwhelmed by ... tons of carbon into the atmosphere each year, mostly as ... may remove up to half this amount, but these current ...
Cached Biology News:University of Toronto finds humans and chimps differ at level of gene splicing 2First-ever 'State of the Carbon Cycle Report' finds troubling imbalance 2
(Date:12/19/2014)... N.Y. , Dec. 18, 2014 Egenix, Inc. ... has been elected Chairman of the Board, to succeed ... and CEO, but will continue as a member of the ... he has added to the company over almost twenty years, ... The Board of Directors has established a Search Committee ...
(Date:12/17/2014)... USA (PRWEB) December 16, 2014 ... manager at Philipps- Universität Marburg’s Department of Physics, ... photonics, in the newly released SPIE Women ... never be too shy to ask questions.” , ... technology, engineering, and mathematics) occupations ranging from university ...
(Date:12/17/2014)... Xeno Diagnostics has again received ... recent COLA inspection. Xeno has met all criteria ... accreditation organization. Accreditation is earned only by laboratories ... operations, demonstrate continued accuracy in the performance of ... survey. , While the Laboratory Excellence ...
(Date:12/17/2014)... Md. , Dec. 17, 2014 CASI ... company dedicated to the acquisition, development and commercialization of ... for the global market with a primary commercial focus ... it has been granted a Type C meeting with ... the meeting will be held in February 2015.  During ...
Breaking Biology Technology:Network, Multitask, Persevere: SPIE Women in Optics Planner Subjects Share from Experience 2Network, Multitask, Persevere: SPIE Women in Optics Planner Subjects Share from Experience 3Xeno Diagnostics Receives 3rd Award for Laboratory Excellence 2CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 2CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 3CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 4CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 5
... (1/25/11) -- Researchers from Boston College, MIT, Clemson and ... increase in the thermoelectric figure of merit of p-type ... in the American Chemical Society journal Nano Letters ... merit, used to measure a material,s relative thermoelectric performance, ...
... Inc. (Nasdaq: CEPH ) today announced positive ... (armodafinil) Tablets [C-IV] in patients experiencing excessive sleepiness associated ... their night shifts (i.e., 4:00 a.m. to 8:00 a.m.), ... significant difference in improvement in overall clinical condition related ...
... 2011 RxTrials, Inc., a network of premier clinical ... leading national clinical research consultant and education provider, has ... WBE certification was presented by the Women,s Business Enterprise ... site visit. The nationally recognized certification from ...
Cached Biology Technology:Nanotech milling produces dramatic increase in thermoelectric performance of bulk semiconductor 2Cephalon Announces Positive Topline Results From a Phase IV Study of NUVIGIL in Shift Work Disorder 2Cephalon Announces Positive Topline Results From a Phase IV Study of NUVIGIL in Shift Work Disorder 3Cephalon Announces Positive Topline Results From a Phase IV Study of NUVIGIL in Shift Work Disorder 4RxTrials Earns National Women-Owned Business Certification 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: