Navigation Links
SMU geothermal conference
Date:10/28/2009

GREEN GEOTHERMAL TECHNOLOGY PIGGYBACKS ON OIL & GAS PRODUCTION

SMU's renowned Geothermal Laboratory will share the blueprint for generating geothermal electricity from waste water produced by oil and gas wells at a conference on the Dallas campus Nov. 3-4. Late registration is available at check-in Nov. 3.

Volatile petroleum prices, federal tax incentives and technology developments are feeding a surge of interest in co-production of geothermal energy from oil and gas wells. The SMU conference is designed to bring business and landowners together with technical, operational and financial players to help incubate geothermal energy ventures.

The oil crisis of the 1970s fed intense interest in geothermal energy, but the technology available at the time required high heat sources, like California's Geysers Field, or costly exploration work to find and reach hot rock buried deep beneath the earth. Interest in the large capital investment required of old-school geothermal production waned when the price of oil came back down.

But new technology developed in association with SMU research provides the capability to produce electricity using much lower water temperatures and smaller, less expensive, turbines that can easily be transported to locations. The technology delivers a cost-effective, environment-friendly alternative energy not dependent on weather variables.

GEOTHERMAL ELECTRICITY FROM OIL & GAS WELLS: HOW DOES IT WORK?

Hot waste water is an ordinary byproduct of many oil and gas wells a costly nuisance when producers have to dispose of it. But circulating the waste water through a specially designed binary power plant installed at the wellhead can drive a turbine to generate electricity. SMU studies indicate there are thousands of oil and gas wells in Texas that could be economical for geothermal development.

Running the binary pump concurrently with oil and gas production of
'/>"/>

Contact: Kim Cobb
214-768-7654
Southern Methodist University
Source:Eurekalert

Page: 1 2

Related biology news :

1. GenVault Corporation to Present at the 2009 BIOCOM Investor Conference
2. UD to host conference on Ethics of Climate Change
3. AACR, NCI and EORTC to host molecular targets and cancer therapeutics conference
4. NIMBioS hosts 200 undergraduates at national research conference
5. Global public health the focus of scientific conference
6. Excellence in Paediatrics conference line-up includes WHO and CDC pandemic speakers
7. IOF-AMGEN Health Professional Awareness Grants awarded at Beijing conference
8. InVitria Presents Zap-CHO Performance Results at PEACe Conference
9. Journalists invited to Darwin/Chicago 2009 conference Oct. 29-31
10. BioConference Live Attracts Major Life Science Sponsors
11. International conference on endothelin
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:3/20/2015)... 20, 2015 Research and Markets ... the "India Sensors Market Forecast and Opportunities ... The sensor market is projected to grow at ... Consumer electronics, automotive, industrial and healthcare sectors are ... country. In addition, adoption of MEMS technology in ...
(Date:3/19/2015)... Inc. (NASDAQ: NXTD ) ("NXT-ID" or the "Company"), ... market, announces its biometric payment technology, the Wocket® smart wallet ... on Washington DC,s Fox 5 News ... Next Great Thing", host Laura Evans calls the ... really big breakthrough in mobile payment.,  Award-winning ...
(Date:3/17/2015)...  MecklerMedia Corporation (OTCQX: MECK) announced its ... ever held in New York City ... 2015 at the Javits Convention Center. ... Acorn Product Development; Axis NJ; c-Link Systems; CoroWare; ... NewBotic Corporation; Neya Systems LLC; Reliabotics; RoboKind; RocketFarm ...
Breaking Biology News(10 mins):India Sensors Market Forecast and Opportunities 2020 - STMicroelectronics held the largest share in 2014 2India Sensors Market Forecast and Opportunities 2020 - STMicroelectronics held the largest share in 2014 3NXT-ID's Wocket Smart Wallet Featured on Fox News Segment, "The Next Great Thing" 2NXT-ID's Wocket Smart Wallet Featured on Fox News Segment, "The Next Great Thing" 3MecklerMedia's RoboUniverse New York Announces Sponsors and Exhibitors, May 11-13, 2015 2
... herbs, especially Mexican oregano, all contain apigenin and luteolin, ... lab by inhibiting an important enzyme, according to two ... cell death in two aggressive human pancreatic cancer cell ... pre-treated cancer cells with apigenin for 24 hours, then ...
... In a study published on line this week in ... Garland, Rosario Fernandez-Godino, and Eric Pierce of the Ocular ... Medical School, along with their colleagues, reported the unexpected ... inherited form of macular degeneration, turning off the animals, ...
... published papers, Tufts University School of Engineering researchers have ... cholera epidemics months before they occur and with a ... remote satellite imaging. Taken together, findings from these ... strengthen intervention efforts before the outbreak of cholera in ...
Cached Biology News:Celery, artichokes contain flavonoids that kill human pancreatic cancer cells 2Researchers report a critical role for the complement system in early macular degeneration 2Researchers report a critical role for the complement system in early macular degeneration 3Tufts scientists develop new early warning system for cholera epidemics 2Tufts scientists develop new early warning system for cholera epidemics 3
(Date:3/25/2015)... March 25, 2015  The Technology Association of ... dedicated to the promotion and economic advancement of ... Health as one of its Top 40 Innovative Technology ... recognize this prestigious group at the 2015 Georgia Technology ... Galleria Centre. TAG,S Top 40 Awards recognize ...
(Date:3/25/2015)... 2015  18 piglets born recently are the ... scientists in the College of Agriculture and Natural Resources at ... in the field of genetic engineering. Bhanu Telugu, ... & Avian Sciences (ANSC) and Ki-Eun Park, PhD, ... genome-edited pigs using a recently developed, groundbreaking technique ...
(Date:3/25/2015)... Proove Biosciences , a commercial ... announce the success of their commercially supported symposium, ... Optimize the Management of Pain, at the 31st Annual ... Maryland on Thursday, March 19th, 2015. , ... Lynn Webster , M.D., former Florida Society of ...
(Date:3/25/2015)... March 25, 2015   Demy-Colton Life Science Advisors ... and business development conferences exclusively for the biopharmaceutical and ... the Biotech CEO Summit. The Biotech ... brings together biotech industry leaders who are united by ... while reaping the rewards of biotech,s new golden age. ...
Breaking Biology Technology:Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 2Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 3Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 4University of Maryland Researchers Successfully Produce Genome-edited Pigs Using Revolutionary Technology 2Proove Biosciences Hosts Symposium on Incorporating Genetic Testing to Optimize the Management of Pain 2Biotech CEO Summit to Bring Key Biotech Leaders Together in Industry Brain Trust 2
... Corporation,(OTC Bulletin Board: CONX), a worldwide developer and ... call on Thursday, September,25, 2008, at 4:00 PM ... for its fiscal year ended June 30, 2008, ... marketing activities., Corgenix invites all those interested ...
... ANNAPOLIS, Md., Sept. 15 PharmAthene, Inc.,(Amex: ... in the development and,commercialization of medical countermeasures ... it has received notification from,the Department of ... Company,s,proposal for its recombinant protective antigen anthrax ...
... Calif., Sept. 15 Advanced Chemical,Transport, one of ... the opening of a new location in Merced, ... environmental services -- hazardous,biological and radioactive waste disposal, ... environmental health and,safety outsourcing -- from the location ...
Cached Biology Technology:PharmAthene Response to DHHS Request for Proposals for Recombinant Protective Antigen Anthrax Vaccine Deemed Technically Acceptable and Within Competitive Range for Procurement Consideration 2PharmAthene Response to DHHS Request for Proposals for Recombinant Protective Antigen Anthrax Vaccine Deemed Technically Acceptable and Within Competitive Range for Procurement Consideration 3PharmAthene Response to DHHS Request for Proposals for Recombinant Protective Antigen Anthrax Vaccine Deemed Technically Acceptable and Within Competitive Range for Procurement Consideration 4Advanced Chemical Transport Opens Merced Facility 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... Buffer I can be used in intracellular ... permeabilize cells and to serve as an ... saponin-mediated cell permeabilization is a reversible process, ... in the presence of saponin during intracellular ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Biology Products: