Navigation Links
'Runner's high' may also strengthen hearts
Date:11/8/2007

Endorphins and other morphine-like substances known as opioids, which are released during exercise, don't just make you feel good -- they may also protect you from heart attacks, according to University of Iowa researchers.

It has long been known that the so-called "runner's high" is caused by natural opioids that are released during exercise. However, a UI study, which is published in the online edition of the American Journal of Physiology's Heart and Circulatory Physiology, suggests that these opioids may also be responsible for some of exercise's cardiovascular benefits.

Working with rats, UI researchers showed that blocking the receptors that bind morphine, endorphins and other opioids eliminates the cardiovascular benefits of exercise. Moreover, the UI team showed that exercise was associated with increased expression of several genes involved in opioid pathways that appear to be critical in protecting the heart.

"This is the first evidence linking the natural opioids produced during exercise to the cardio-protective effects of exercise," said Eric Dickson, M.D., UI associate professor and head of emergency medicine in the Roy J. and Lucille A. Carver College of Medicine and the study's lead investigator. "We have known for a long time that exercise is great for the heart. This study helps us better understand why."

Studies have shown that regular vigorous exercise reduces the risk of having a heart attack and improves survival rates following heart attack, even in people with cardiovascular disease. In addition, exercise also decreases the risk of atherosclerosis, stroke, osteoporosis and even depression. However, despite these proven health benefits, much less is understood about how exercise produces these benefits.

The UI study investigated the idea that the opioids produced by exercise might have a direct role in cardio-protection. The researchers compared rats that exercised with rats that did not. As
'/>"/>

Contact: Jennifer Brown
jennifer-l-brown@uiowa.edu
319-335-9917
University of Iowa
Source:Eurekalert

Page: 1 2

Related biology news :

1. Risk of common vaginal infection linked to preterm birth appears higher for blacks
2. High blood pressure, low energy -- a recipe for heart failure
3. September Geology and GSA Today media highlights
4. Highlights from the September 2007 Journal of the American Dietetic Association
5. Selexis Announces Advanced Approach to Maximize Power of Genetic Elements for Rapid Development of High Performance Cell Lines
6. Study finds a high rate of asthma in college athletes
7. Coral reef fish harbor an unexpectedly high biodiversity of parasites
8. Improved e-jet printing provides higher resolution and more versatility
9. AGU journal highlights -- Sept. 6, 2007
10. IDEMA Reveals Program Highlights for DISKCON USA 2007
11. Rutgers high school outreach gets $3 million boost from NSF
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/18/2013)... Kingdom, the Energy Department,s National Renewable Energy Laboratory ... published a paper describing a novel cellulose-degrading enzyme ... , commonly known as the gribble. , ... relatively unique ability to produce their own enzymes ... the biomass they eat. New biomass-degrading enzymes from ...
(Date:6/18/2013)... not a hacker lab. At Brandeis University, sophisticated ... are helping scientists understand the complex interplay between ... the virus, outer "shell" critical for replication. ... what we are finding will help researchers alter ... post-doctoral fellow Jason Perlmutter, first author of the ...
(Date:6/18/2013)... Torrent, Ph.D., Medical Research Council, Laboratory of Molecular ... a 2013 ICAAC Young Investigator Award. Torrent is ... developing the first algorithm to predict antimicrobial regions ... said, "we are now applying this algorithm to ... antimicrobial peptide leads with very appealing results." ...
Breaking Biology News(10 mins):Novel enzyme from tiny gribble could prove a boon for biofuels research 2Computer modeling technique goes viral at Brandeis 2The American Society for Microbiology honors Marc Torrent 2
... could help ships sailing smoothly. The growth of marine ... major cause of increased energy costs in the naval ... this so called 'bio-fouling'. , Ralph Liedert from the ... work on the application of artificial shark skin in ...
... that provides a vital passage through a bacterium's outer ... is built of the 'wrong' material, scientists at The ... a finding that has long-term implications for understanding diseases ... disease, and mad cow disease. , The paper in ...
... of different items by scanning the tiny barcode printed ... could make it just as easy to identify genes, ... tagging them with color-coded probes made out of synthetic ... Luo, Cornell assistant professor of biological engineering, has created ...
Cached Biology News:Beyond genes: Lipid helps cell wall protein fold into proper shape 2Beyond genes: Lipid helps cell wall protein fold into proper shape 3Tagging pathogens with synthetic DNA 'barcodes' 2Tagging pathogens with synthetic DNA 'barcodes' 3
(Date:6/18/2013)... WILMINGTON, Delaware , June 18, 2013 /PRNewswire/ ... to announce the release of the HELM biomolecular ... permissive open source MIT licence. HELM ... of a wide range of biomolecules (e.g. proteins, ... render existing small-molecule and sequence-based informatics methodologies impractical ...
(Date:6/18/2013)... -- The "Bioinformatics Market By Sector (Molecular Medicine, Agriculture, ... Data Analysis Services) & Application (Genomics, Proteomics & Drug Design) - Global ... Restraints, and Opportunities in North America , ... and Rest of World. Browse , ... Figures 364 Pages and an in-depth ...
(Date:6/18/2013)... , June 18, 2013 ... ) has announced the addition of the ... and Companies " to their offering. ... report briefly reviews basics of human genome ... applications. Current large and small sequencers are ...
(Date:6/18/2013)... DUBLIN , June 18, 2013 ... Markets ( http://www.researchandmarkets.com/research/cmbgcv/north_american ) has announced ... American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes ... Radiation Therapy (I131, Y-90)], [Applications (Cancer/Oncology, ... to 2017" report to their ...
Breaking Biology Technology:The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools 2Bioinformatics Market Worth $7.5 Billion by 2017 2Bioinformatics Market Worth $7.5 Billion by 2017 3DNA Sequencing: Technologies, Markets and Companies - 2013 Report 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 3
... that allow nanoparticles to assemble themselves into designer materials ... of Iowa State University and the Ames Laboratory reports ... Science . Travesset, an associate professor of physics ... of Energy,s Ames Laboratory, writes in the journal,s Perspectives ...
... today announced that Jeff Liter has been appointed as ... "Jeff,s diverse background in all aspects of corporate development ... Said Matt McManus, President and CEO, PrimeraDx.  "PrimeraDx,s strategy ... Plex system in the MDx market and define ...
... from the Faculty of Biology and Biotechnology at the ... of Biological Chemistry explaining why enzymes used for ... In collaboration with researchers from Berlin, they used spectroscopic ... that lead to the inactivation of the enzyme,s iron ...
Cached Biology Technology:Iowa State, Ames Lab physicist says nanoparticle assembly is like building with LEGOs 2PrimeraDx Appoints Jeff Liter as VP of Corporate Development 2If oxygen becomes the undoing of proteins 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: