Navigation Links
Resilience in an aging society: GSA showcases cutting-edge meeting topics
Date:10/31/2008

politician and Georgetown University health policy expert; Kathleen Francovic, PhD, CBS News director of surveys; and Chris Jennings of Jennings Policy Strategies, former senior health policy advisor during the Clinton Administration.

Congressional Briefing on Civic Engagement
Tuesday, November 25, at 8:30 a.m.
Location: U.S. Capitol, Washington, DC
Both presidential candidates support an expanded federal commitment to volunteer service, so advocates are working with congressional leaders to enact civic engagement legislation early in the 111th Congress. Senate and House staffers are slated to present their bosses' initiatives, while policy makers, advocates, and volunteers will share their visions for continued community contributions by older Americans. Bus transportation to this breakfast briefing is available for those staying in National Harbor.

Institute of Medicine Report: The Future Health Care Workforce for Older Americans
Sunday, November 23, at 3:30 p.m.
Location: Potomac Ballroom A
This session, part of GSA's presidential symposium series, will explore ""Retooling for an Aging America: Building the Health Care Workforce," an April 2008 report from the Institute of Medicine. The publication found that America's aging citizens are facing a health care workforce too small and unprepared to meet their needs. Judith Salerno, MD, executive officer of the Institute of Medicine, will serve as discussant.

Launch of the MacArthur Foundation Research Network on an Aging Society
Friday, November 21, at 3 p.m.
Location: National Harbor 10
The MacArthur Foundation Research Network on an Aging Society is an interdisciplinary group of scholars recently assembled to analyze the modifications required in our major institutions to facilitate a productive, equitable society in the United States. To celebrate its launch, an expert panel will present new life expectancy and populat
'/>"/>

Contact: Todd Kluss
tkluss@geron.org
202-587-2839
The Gerontological Society of America
Source:Eurekalert

Page: 1 2 3 4

Related biology news :

1. ORNL resilience plan to help Tennessee, Mississippi and South Carolina communities beat disaster
2. Resilience concepts poised to aid management of coastal marine ecosystems
3. Small animal imaging facility is big boon to research
4. Hebrew SeniorLife researchers search for aging, osteoporosis genes
5. Depression, aging, and proteins made by a virus may all play role in heart disease
6. CU-Boulder worm study sheds light on human aging, inherited diseases
7. UVA researchers explain cell response to skin-damaging UV rays
8. New thoracic imaging approach can pinpoint underlying venous problems
9. Stowers Institutes Xie Lab demonstrates dual intrinsic and extrinsic control of stem cell aging
10. Quantitative PET imaging finds early determination of effectiveness of cancer treatment
11. Genes identified to protect brassicas from damaging disease
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:8/29/2014)... from the University of Texas Medical Branch at Galveston has ... antibodies can completely protect monkeys against a lethal dose of ... time when the disease is severe. , Thomas Geisbert, professor ... Nature discussing advances in Ebola treatment research. The filoviruses ... most deadly of pathogens, with fatality rates of up to ...
(Date:8/29/2014)... This news release is available in German . ... are key players in the natural nitrogen cycle on ... these specialist bacteria were thought to depend on nitrite ... scientists led by Holger Daims, a microbiologist at the ... can use hydrogen as an alternative source of energy. ...
(Date:8/29/2014)... nucleus, chromosomal DNA is tightly bound to structural ... chromatin. Until about two decades ago, histones were ... material around which the glamorous DNA strands were ... appreciation for how DNA/histone interactions govern gene expression. ... studying the sequence of the genome from cancer ...
Breaking Biology News(10 mins):Leading Ebola researcher at UTMB says there's an effective treatment for Ebola 2Hydrogen powers important nitrogen-transforming bacteria 2Hydrogen powers important nitrogen-transforming bacteria 3'K-to-M' histone mutations: How repressing the repressors may drive tissue-specific cancers 2'K-to-M' histone mutations: How repressing the repressors may drive tissue-specific cancers 3
... The bird enthusiast who chronicled the adventures of a ... of Telegraph Hill" knows most of the parrots by name, ... one bird from another. While it has been known for ... our day-to-day environment, the underlying neural mechanism has been less ...
... reduce age-related macular degeneration ,(AMD) which is the major cause ... the third cause of global blindness, according to,a study published ... There are two types of AMD, wet and dry. ... loss. A team of researchers across seven European,countries and co-ordinated ...
... New Zealand mud snail currently inhabits four of the five ... to a Penn State team of researchers. These tiny creatures ... food replacements for the native species. "These snails have an ... Levri, associate professor of biology at Penn State,s Altoona Campus. ...
Cached Biology News:Distinguishing between 2 birds of a feather 2Distinguishing between 2 birds of a feather 3Eat oily fish at least once a week to protect your eyesight in old age 2Tiny invasive snail impacts Great Lakes, alters ecology 2Tiny invasive snail impacts Great Lakes, alters ecology 3
(Date:8/28/2014)... 2014 SPIE Fellow Glenn Boreman, Professor ... Science and Director of the Center for Optoelectronics and ... Charlotte, and co-founder and Chairman of the Board of ... 2015 Vice President of SPIE, the international society for ... announced recent election results at the Annual General Meeting ...
(Date:8/28/2014)... A new research platform uses a ... tiny structures undergoing stress and heating, an ... designs for microelectronics and batteries., This new ... about how heating and the surface stress ... Researchers have discussed the merits of surface-stress ...
(Date:8/28/2014)... BOSTON , Aug. 28, 2014  Next month, executives ... at three key industry events beginning with Patient-Centered Clinical ... Hotel in Boston , September 4-5. Patient ... , and Aaron Fleishman will share insights on ... how a variety of tactics – from media to mobile ...
(Date:8/28/2014)... Florida State University research team has led to a ... white light, and convert photon energy directly to mechanical ... , Biwu Ma, associate professor in the Department of ... Engineering, created the molecule in a lab about a ... creation has many other unique capabilities. , For example, ...
Breaking Biology Technology:Glenn Boreman, UNC Professor and Plasmonics Co-Founder, Elected to SPIE Presidential Chain 2New analytical technology reveals 'nanomechanical' surface traits 2New analytical technology reveals 'nanomechanical' surface traits 3BBK Worldwide Leads Sessions at Key September Events 2Novel 'butterfly' molecule could build new sensors, photoenergy conversion devices 2
... ... January 22 , - First-Ever Young Women ... Elsevier announced today the winners of the Asian Young ... and citation database of peer-reviewed literature,and the Third World Organisation for Women in ...
... LEXINGTON, Mass. , and HEIDELBERG, Germany , ... at Children,s Hospital Boston chose febit,s HybSelect technology which will ... of genes of interest for resequencing. In January the core ... to perform HybSelect. , "We feel that febit,s HybSelect technology ...
... ... product offering, PrescriberPRO Mobile. ,PrescriberPRO Mobile is a state-of-the-art smart phone application ... medical prescribers. The application will provide names, addresses, and other account information on ... ...
Cached Biology Technology:Scopus(R), TWOWS and TWAS Announce Young Women Researcher Award Recipients in Asia 2Scopus(R), TWOWS and TWAS Announce Young Women Researcher Award Recipients in Asia 3Scopus(R), TWOWS and TWAS Announce Young Women Researcher Award Recipients in Asia 4Scopus(R), TWOWS and TWAS Announce Young Women Researcher Award Recipients in Asia 5Scopus(R), TWOWS and TWAS Announce Young Women Researcher Award Recipients in Asia 6Scopus(R), TWOWS and TWAS Announce Young Women Researcher Award Recipients in Asia 7Molecular Genetics Core Facility at Children's Hospital Boston Selects HybSelect from febit for Targeted Resequencing 2Molecular Genetics Core Facility at Children's Hospital Boston Selects HybSelect from febit for Targeted Resequencing 3Healthcare Data Solutions Announces New Mobile Application, PrescriberPRO Mobile 2Healthcare Data Solutions Announces New Mobile Application, PrescriberPRO Mobile 3
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... raised against a partial recombinant NFKBIB. ... 145 a.a) partial recombinant protein with GST tag. ... Accession: BC015528 ... OMIM: 604495, GeneID: ...
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: