Navigation Links
Researchers study virus with unusual properties
Date:12/8/2008

A team of researchers from Penn State University and the University of Chicago has uncovered clues that may explain how and why a particular virus, called N4, injects an unusual substance -- an RNA polymerase protein -- into an E. coli bacterial cell. The results, which are published in the current issue of the journal Molecular Cell, contribute to improved understanding of the infection strategies used by viruses that attack bacterial cells. Such viruses are known as bacteriophages, or phages. The results also may help other researchers to come up with new ideas about ways to kill E. coli bacteria, which can be dangerous to humans.

"Most phages inject only their own DNA into bacterial cells," said Katsu Murakami, a Penn State assistant professor in the Department of Biochemistry and Molecular Biology and a leader of the study. "These phages then use the host bacterial cell's RNA polymerase to synthesize messenger RNA through a process called transcription, which ultimately results in the creation of new phage proteins. These new proteins are used to construct new phages inside the bacterial cell. But the phage that we are studying is different. It injects both its own DNA and its own RNA polymerase into bacterial cells, so it can begin the process of transcription without any help from the bacterial host's RNA polymerase."

The team says that the N4 phage that they are studying is the only phage that they know of that injects its own RNA polymerases into bacterial cells. "We are particularly interested in finding out why N4 injects its own RNA polymerase into bacterial cells and how the N4 RNA polymerase finds the N4 DNA and initiates transcription -- and, ultimately, the creation of new N4 phages -- once it is inside a bacterial cell," said Murakami.

To begin to answer these questions, team member Michael Gleghorn, a former graduate student in the Penn State Department of Biochemistry and Molecular Bi
'/>"/>

Contact: Barbara K. Kennedy
science@psu.edu
814-863-4682
Penn State
Source:Eurekalert  

Page: 1 2 3

Related biology news :

1. Key to curing obesity may lie in worms that destroy their own fat: McGill researchers
2. UC Davis researchers exploring gene therapy to fight AIDS
3. Researchers solve piece of large-scale gene silencing mystery
4. A little wine boosts omega-3 in the body: Researchers find a novel mechanism for a healthier heart
5. Researchers examine role of soil patterns in dam restoration
6. USC researchers head global effort to study genetic risks that contribute to psychiatric diseases
7. PNNL researchers earn top honors at Supercomputing conference
8. Einstein researchers develop technique to count messages made by single genes
9. House Ear Institute, TGen and Belgian researchers identify gene in age-related hearing loss
10. Researchers learn that some good cholesterol isnt good enough
11. URI researchers help score knockout punch on birch tree pest
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Researchers study virus with unusual properties
(Date:6/18/2013)... Kingdom, the Energy Department,s National Renewable Energy Laboratory ... published a paper describing a novel cellulose-degrading enzyme ... , commonly known as the gribble. , ... relatively unique ability to produce their own enzymes ... the biomass they eat. New biomass-degrading enzymes from ...
(Date:6/18/2013)... not a hacker lab. At Brandeis University, sophisticated ... are helping scientists understand the complex interplay between ... the virus, outer "shell" critical for replication. ... what we are finding will help researchers alter ... post-doctoral fellow Jason Perlmutter, first author of the ...
(Date:6/18/2013)... Torrent, Ph.D., Medical Research Council, Laboratory of Molecular ... a 2013 ICAAC Young Investigator Award. Torrent is ... developing the first algorithm to predict antimicrobial regions ... said, "we are now applying this algorithm to ... antimicrobial peptide leads with very appealing results." ...
Breaking Biology News(10 mins):Novel enzyme from tiny gribble could prove a boon for biofuels research 2Computer modeling technique goes viral at Brandeis 2The American Society for Microbiology honors Marc Torrent 2
... could help ships sailing smoothly. The growth of marine ... major cause of increased energy costs in the naval ... this so called 'bio-fouling'. , Ralph Liedert from the ... work on the application of artificial shark skin in ...
... that provides a vital passage through a bacterium's outer ... is built of the 'wrong' material, scientists at The ... a finding that has long-term implications for understanding diseases ... disease, and mad cow disease. , The paper in ...
... of different items by scanning the tiny barcode printed ... could make it just as easy to identify genes, ... tagging them with color-coded probes made out of synthetic ... Luo, Cornell assistant professor of biological engineering, has created ...
Cached Biology News:Beyond genes: Lipid helps cell wall protein fold into proper shape 2Beyond genes: Lipid helps cell wall protein fold into proper shape 3Tagging pathogens with synthetic DNA 'barcodes' 2Tagging pathogens with synthetic DNA 'barcodes' 3
(Date:6/18/2013)... WILMINGTON, Delaware , June 18, 2013 /PRNewswire/ ... to announce the release of the HELM biomolecular ... permissive open source MIT licence. HELM ... of a wide range of biomolecules (e.g. proteins, ... render existing small-molecule and sequence-based informatics methodologies impractical ...
(Date:6/18/2013)... -- The "Bioinformatics Market By Sector (Molecular Medicine, Agriculture, ... Data Analysis Services) & Application (Genomics, Proteomics & Drug Design) - Global ... Restraints, and Opportunities in North America , ... and Rest of World. Browse , ... Figures 364 Pages and an in-depth ...
(Date:6/18/2013)... , June 18, 2013 ... ) has announced the addition of the ... and Companies " to their offering. ... report briefly reviews basics of human genome ... applications. Current large and small sequencers are ...
(Date:6/18/2013)... DUBLIN , June 18, 2013 ... Markets ( http://www.researchandmarkets.com/research/cmbgcv/north_american ) has announced ... American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes ... Radiation Therapy (I131, Y-90)], [Applications (Cancer/Oncology, ... to 2017" report to their ...
Breaking Biology Technology:The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools 2Bioinformatics Market Worth $7.5 Billion by 2017 2Bioinformatics Market Worth $7.5 Billion by 2017 3DNA Sequencing: Technologies, Markets and Companies - 2013 Report 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 3
... that allow nanoparticles to assemble themselves into designer materials ... of Iowa State University and the Ames Laboratory reports ... Science . Travesset, an associate professor of physics ... of Energy,s Ames Laboratory, writes in the journal,s Perspectives ...
... today announced that Jeff Liter has been appointed as ... "Jeff,s diverse background in all aspects of corporate development ... Said Matt McManus, President and CEO, PrimeraDx.  "PrimeraDx,s strategy ... Plex system in the MDx market and define ...
... from the Faculty of Biology and Biotechnology at the ... of Biological Chemistry explaining why enzymes used for ... In collaboration with researchers from Berlin, they used spectroscopic ... that lead to the inactivation of the enzyme,s iron ...
Cached Biology Technology:Iowa State, Ames Lab physicist says nanoparticle assembly is like building with LEGOs 2PrimeraDx Appoints Jeff Liter as VP of Corporate Development 2If oxygen becomes the undoing of proteins 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: