Navigation Links
Researchers equip robot sub with sensory system inspired by blind fish
Date:3/29/2010

n when faced with a wide variety of sensor information."

In fact, CoTeSys specializes in just this kind of interdisciplinary cooperation. The research cluster brings together around 100 scientists working in widely differing fields at five universities and research institutes in the Munich area, in the interest of developing better cognitive capabilities for technical systems. The goal is to make robots more self-sufficient, able to analyze for themselves and flexibly respond to the situations in which they find themselves -- from recognizing their surroundings through to independently performing their allotted tasks. As part of the Excellence Initiative, the Federal and state governments have set aside a total of 28 million euros in funding for the joint project coordinated by the Technische Universitt Mnchen (TUM).


'/>"/>

Contact: Markus Bernards
bernards@zv.tum.de
49-892-892-2562
Technische Universitaet Muenchen
Source:Eurekalert

Page: 1 2 3 4 5 6

Related biology news :

1. Researchers identify proteins involved in new neurodegenerative syndrome
2. Texas researchers and educators head for Antarctica
3. MGH researchers describe new way to identify, evolve novel enzymes
4. University of Pennsylvania researchers develop formula to gauge risk of disease clusters
5. U of MN researchers discover noninvasive diagnostic tool for brain diseases
6. U of Minnesota researchers discover noninvasive diagnostic tool for brain diseases
7. Researchers discover new strategies for antibiotic resistance
8. Researchers find new taste in fruit flies: carbonated water
9. Binghamton University researchers investigate evolving malaria resistance
10. UIC researchers find promising new targets for antibiotics
11. Researchers develop simple method to create natural drug products
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/24/2015)... June 24, 2015  Synaptics Inc. (NASDAQ: ... solutions, today announced that Sharp has selected its ... authentication for its latest flagship smartphone device, the ... 200 million shipments of its fingerprint ID sensor ... strength, scalability and leadership in the biometrics market ...
(Date:6/24/2015)... June 24, 2015 Biometry authentication provider ... biometric password solution one face in. ... one face in, entering the expanding biometric ... affordable multifactor-authentication biometric answer to the password problem. ... in partnership with KeyLemon, one face in allows ...
(Date:6/23/2015)... June 22, 2015 ... addition of the "Body-Worn Temperature Sensors Market ... and Forecast 2014 - 2020" report to ... analysis of the global body-worn temperature sensors market. ... segmented on the basis of types, care setting, ...
Breaking Biology News(10 mins):Synaptics Brings Natural ID Technology to Sharp's Newest Flagship Smartphone 2KeyLemon Announces Partnership With Biometric Password Solution onefacein 2Body-Worn Temperature Sensors Market - Global Industry Analysis 2
... fewer television advertisements for certain foods, including those for ... to a report posted online today that will appear ... Pediatrics & Adolescent Medicine , one of the JAMA/Archives ... racial gaps in exposure to all food advertising have ...
... Saber-toothed cats may be best known for their supersized canines, ... before delivering the fatal bite, says a new study in ... "saber-toothed tiger," the extinct cat Smilodon fatalis roamed ... large mammals such as bison, camels, mastodons and mammoths. Telltale ...
... worry about the effects of air pollution on their health ... and fine particles in the air during pregnancy does not ... -- a serious condition that arises only during pregnancy -- ... at Buffalo epidemiologist. , The research was conducted in ...
Cached Biology News:Kids now see fewer television ads for sweets and beverages, but more for fast food 2Why you should never arm wrestle a saber-toothed tiger 2Air pollution doesn't increase risk of preeclampsia, early delivery, study finds 2
(Date:6/30/2015)... SAN DIEGO , June 30, 2015 /PRNewswire/ ... Continuing Education in Biosciences (CCE/Bio) and UC San ... microbial fermentation, to be held Aug.  12 – ... agenda ).  This three-day workshop provides an intense ... in industrial biotechnology, and is well-suited to biologists, ...
(Date:6/30/2015)... VANCOUVER , June 30, 2015 /PRNewswire/ - ... a clinical stage regenerative medicine company focused on ... the first participant in its Phase 1/2 clinical ... of chronic unilateral Achilles tendinosis, has been enrolled ... to intra-tendon ultrasound-guided injections. RCT-01 is comprised of ...
(Date:6/30/2015)... ... June 30, 2015 , ... ... has accepted the position of vice president of instruction at Chippewa Valley Technical ... “I greatly appreciated the opportunity to lead SIUE during the past three years,” ...
(Date:6/30/2015)... ... June 30, 2015 , ... ... launched “Cannavoices,” an unprecedented digital video and broadcast initiative. Produced by filmmakers, the ... dynamic collection of legal medical cannabis stories ever assembled. , Cannavoices profiles ...
Breaking Biology Technology:UC San Diego Extension to Offer Third Annual Microbial Fermentation Workshop 2RepliCel Life Sciences Enrolls First Participant in Phase 1/2 Clinical Trial of RCT-01 for Chronic Achilles Tendinosis 2RepliCel Life Sciences Enrolls First Participant in Phase 1/2 Clinical Trial of RCT-01 for Chronic Achilles Tendinosis 3RepliCel Life Sciences Enrolls First Participant in Phase 1/2 Clinical Trial of RCT-01 for Chronic Achilles Tendinosis 4SIUE’s Furst-Bowe Accepts VP of Instruction at CVTC 2SIUE’s Furst-Bowe Accepts VP of Instruction at CVTC 3Cannavoices Launches a Legal Medical Cannabis Documentary Initiative 2Cannavoices Launches a Legal Medical Cannabis Documentary Initiative 3
... define state,s economic successesRESEARCH TRIANGLE PARK, N.C., April ... is shining a spotlight on North Carolina,s long-term ... American headquarters in Research Triangle Park, is one ... flu treatments. GSK makes Relenza at its plant ...
... (NYSE: CVD ) today reported earnings for its ... share versus $0.76 per diluted share in the first quarter ... centralized ECG gain on sale). "On a consolidated basis, first ... foreign exchange), operating margin was 12.7%, and diluted EPS of ...
... 29 Orchid Cellmark Inc., (Nasdaq: ... Chief Executive Officer of Orchid Cellmark, is scheduled to present ... New York City on Wednesday, May 13, 2008 at 4:00 ... discuss the company,s recent and ongoing progress. A link to ...
Cached Biology Technology:NC Biomanufacturers Supply Defense for World vs. Flu 2Covance Reports First Quarter Revenue of $441M and EPS of $0.63; Updates Full Year Financial Targets 2Covance Reports First Quarter Revenue of $441M and EPS of $0.63; Updates Full Year Financial Targets 3Covance Reports First Quarter Revenue of $441M and EPS of $0.63; Updates Full Year Financial Targets 4Covance Reports First Quarter Revenue of $441M and EPS of $0.63; Updates Full Year Financial Targets 5Covance Reports First Quarter Revenue of $441M and EPS of $0.63; Updates Full Year Financial Targets 6Covance Reports First Quarter Revenue of $441M and EPS of $0.63; Updates Full Year Financial Targets 7Covance Reports First Quarter Revenue of $441M and EPS of $0.63; Updates Full Year Financial Targets 8Covance Reports First Quarter Revenue of $441M and EPS of $0.63; Updates Full Year Financial Targets 9Covance Reports First Quarter Revenue of $441M and EPS of $0.63; Updates Full Year Financial Targets 10Covance Reports First Quarter Revenue of $441M and EPS of $0.63; Updates Full Year Financial Targets 11Covance Reports First Quarter Revenue of $441M and EPS of $0.63; Updates Full Year Financial Targets 12Orchid Cellmark to Present at the 2009 Bank of America Health Care Conference on May 13th 2Orchid Cellmark to Present at the 2009 Bank of America Health Care Conference on May 13th 3
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Biology Products: