Navigation Links
Research results confirm need for protection against ticks that carry Lyme disease
Date:7/20/2010

Research on the population of black-legged ticks, which can transmit Lyme disease from host animals to humans, reinforces that it is important to take preventative measures when spending time outdoors.

University of Illinois graduate student Jennifer Rydzewski conducted a four-year survey of black-legged ticks (also known as deer ticks), their host animals, and their habitat preferences in Cook, Lake, DuPage, and Piatt Counties. The survey confirmed the presence of ticks in all four counties and ticks carrying Lyme disease in Piatt County. Higher numbers of ticks were found along the Des Plaines River corridor.

"Their small size makes ticks really difficult to see. They're about the size of a poppy seed," Rydzewski said.

"Ticks in the nymph stage of their life cycle are responsible for the most human cases of Lyme disease because their peak seasonal activity coincides with increased human activity outdoors during the warmer summer months, so it's important for people to take extra precautions."

In humans, early symptoms of Lyme disease are often nondescript, flu-like symptoms such as fever, headache, and fatigue, making it difficult to diagnose from symptoms alone. In about 70 percent of the cases, people will develop the typical bullseye-shaped rash associated with Lyme disease. If it's caught in the early stages it can be treated with broad-spectrum antibiotics; however, if it's not treated early, the result can be long-term severe joint pain, arthritis and neurological damage. The disease is named after the town of Lyme, Connecticut, where a number of cases were identified in 1975.

Rydzewski used a disease triangle to illustrate how Lyme disease is spread. One point of the triangle is the host in this case, it could be a mouse, deer, or other bird or small mammal. A second point on the triangle is the pathogen Borrelia burgdoferi. Bacteria, in the case of Lyme disease, are spread by a vector, the ti
'/>"/>

Contact: Debra Levey Larson
dlarson@illinois.edu
217-244-2880
University of Illinois College of Agricultural, Consumer and Environmental Sciences
Source:Eurekalert  

Page: 1 2 3

Related biology news :

1. A baby, Skype and water research partnership with Israel
2. New research will unravel Arizonas prehistoric puzzle of the Hohokam ceramic industry
3. 6 new research units established
4. MSU sea lamprey research sheds light on how stress hormones evolved
5. LSU researchers secure NSF rapid response grants to study impact of oil spill
6. Research develops simple recipe for fungus-free horseradish
7. UT researchers: English ivy may give sunblock a makeover
8. NIH awards Rice $1.7M for cartilage-regeneration research
9. K-State researchers find gene-silencing nanoparticles may put end to pesky summer pest
10. New biotech company grows from MCG diabetes and genomic research
11. WSU researchers find way to make cancer cells more mortal
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Research results confirm need for protection against ticks that carry Lyme disease
(Date:4/17/2014)... NJ. April 16, 2014. Kessler Foundation has been ... million from the Department of Defense Spinal Cord ... principal investigator for the randomized, double-blinded, controlled, multi-site ... bone and muscle strength after spinal cord injury. ... & Engineering Research at Kessler Foundation. Two additional ...
(Date:4/17/2014)... births, Down syndrome - or trisomy 21 - is ... results from a chromosomal abnormality where cells of affected ... of the human genome). A study conducted by Stylianos ... Medicine and Development at the University of Geneva (UNIGE) ... light on how the extra chromosome 21 upsets the ...
(Date:4/17/2014)... ago, Katia Silvera , a postdoctoral scholar at the ... field trip in a mountainous area in central Panama when ... , Unable to identify it, they contacted German Carnevali, a ... be an unnamed species. So Carnevali recently named it after ... genus name, comprising about 40 species in the world. ...
Breaking Biology News(10 mins):Kessler Foundation awarded Department of Defense grant for spinal cord injury research 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 3Orchid named after UC Riverside researcher 2Orchid named after UC Riverside researcher 3
... 2013) The Algae Biomass Organization (ABO), the trade ... of "Industrial Algae Measurements, Version 6.0" (IAM 6.0), ... by the organization for measuring and comparing algae ... new technologies to create fuels, feeds, nutritional supplements, ...
... this Moderate Resolution Imaging Spectroradiometer (MODIS) satellite image collected on ... Terra satellite and actively burning areas, detected by MODIS,s thermal ... is banned in Indonesia, but that does not always stop ... unusual dry spell in the area (this is usually the ...
... influence actual heart health, according to new research. A study ... ways in which your spouse is supportive and how ... on your overall cardiovascular health. The findings reveal that ... other as ambivalent that is, sometimes helpful and sometimes ...
Cached Biology News:ABO updates standards for measuring algae industry operations 2ABO updates standards for measuring algae industry operations 3ABO updates standards for measuring algae industry operations 4Heart disease risk linked with spouses' social support 2
(Date:1/15/2014)... DTS Language Services, Inc . is ... for Life Science organizations who need document translations. Clients ... of their documents in advance with a selection of nearly ... translations, often a critical factor in clinical and scientific fields, ...
(Date:1/14/2014)... Doylestown, PA (PRWEB) January 14, 2014 Date: ... p.m. , Location: Warrington Country Club, 1360 Almshouse Road, Warrington, ... only national nonprofit organization solely dedicated to finding a cure ... those affected worldwide, will host its annual Crystal Ball on ...
(Date:1/14/2014)... (PRWEB) January 14, 2014 EquitiesIQ, a ... Inc. (OTCQB: ALQA). Alliqua is an emerging biomedical company ... the wound care market. , Free report download: ... with a seasoned management team and Board, which launched ...
(Date:1/14/2014)... Jan. 14, 2014  RXi Pharmaceuticals Corporation (OTCQX: RXII), ... commercializing innovative therapies addressing major unmet medical needs ... the Notice of Allowance from the United States ... RNAi compounds (sd-rxRNA®), for the treatment of fibrosis. ...
Breaking Biology Technology:DTS Improves Efficiency for Life Science Document Translations 2Hepatitis B Foundation to Host Annual Crystal Ball Gala 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 2RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 3
... CARY, N.C., May 19, 2011 ... its flexible 100% web-based Life Science Study Management ... successfully used globally by Leading European and USA ... eStudy,s on-line study design, management, communication, data collection ...
... CLARA, Calif., May 19, 2011 The 2012 federal ... National Nanotechnology Initiative (NNI), a federal interagency research and ... manipulation of matter at the nanoscale—a measurement of particles ... meter) in size.  While nanoscale materials are found in ...
... Inc., a Massachusetts-based biopharmaceutical company, announced today that it ... Administration on a Special Protocol Assessment (SPA) for a ... agent for patients with newly diagnosed prostate cancer. The ... with definitive results expected by 2015. The randomized study ...
Cached Biology Technology:Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 2Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 3Environmental Training Center Prepares Companies to Handle Nanotechnology Environmental and Human Safety Impacts 2Advantagene Announces SPA Agreement With FDA to Launch Phase 3 Trial for Novel Vaccine Aimed at Preventing Prostate Cancer Recurrence 2
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products: