Navigation Links
Research identifies gene with likely role in premenstrual disorder
Date:2/9/2010

Scientists have identified a gene they say is a strong candidate for involvement in premenstrual dysphoric disorder (PMDD) and other maladies associated with the natural flux in hormones during the menstrual cycle. In a paper published Monday in the Proceedings of the National Academy of Sciences, Rockefeller University researchers detail experiments in mice showing that a common human variant of the gene increases anxiety, dampens curiosity and tweaks the effects of estrogen on the brain, impairing memory. If applied in the clinic, the work could help diagnose and treat cognitive and mood disorders related to the menstrual cycle and inform treatments during menopause, such as hormone replacement therapy, researchers say.

The experiments homed in on the gene for a protein that, among other things, works with estrogen to enhance the adaptability of neurons in the hippocampus, a brain region that plays a key role in mood, cognition and memory. A change in one amino acid in this gene, called brain-derived neurotrophic factor (BDNF), creates the variant BDNF Met, which is carried by 20 to 30 percent of Caucasian women. Past research showed that it is a risk factor for psychiatric problems such as depression and bipolar disorder and is generally associated with higher anxiety and impaired memory. The Rockefeller scientists and their colleagues at Weill Cornell Medical College now show that the performance of memory tasks by mice with both the variant and the regular gene depends on where they are in their estrous cycles. It is the first time that a genotype has been shown to interact with a hormone cycle to influence a cognitive behavior, one reviewer of the paper wrote. The researchers also show that mice with the variant gene are more skittish- they spent much less time in the vulnerable center of a well-lit cage before scurrying to a corner. As a result, they spent less time exploring objects placed in their cage.

"Even though the BDNF Met m
'/>"/>

Contact: Brett Norman
bnorman@rockefeller.edu
212-327-7613
Rockefeller University
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. Research shows skeleton to be endocrine organ
2. Newly created cancer stem cells could aid breast cancer research
3. Dominant cholesterol-metabolism ideas challenged by new research
4. Researchers identify proteins involved in new neurodegenerative syndrome
5. Texas researchers and educators head for Antarctica
6. MGH researchers describe new way to identify, evolve novel enzymes
7. University of Pennsylvania researchers develop formula to gauge risk of disease clusters
8. University of Oregon researcher finds that on waters surface, nitric acid is not so tough
9. U of MN researchers discover noninvasive diagnostic tool for brain diseases
10. U of Minnesota researchers discover noninvasive diagnostic tool for brain diseases
11. Story ideas from the Journal of Lipid Research
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/16/2014)... CRG researchers shed ... Journal of Cell Biology describes how Topo 2 disentangles ... At this very moment thousands of our body,s cells are ... body repairs damaged tissues and regenerates others like skin and ... during which the cell duplicates its genetic material and separates ...
(Date:9/16/2014)... , Sept. 16, 2014  Valencell, Inc., a leader ... as one of 18 "Showcase Companies" representing ... the annual CED Tech Venture Conference on September 16-17 ... Convention Center in Raleigh, North Carolina ... lead a discussion during the "Digital Health Spotlight Sector" ...
(Date:9/15/2014)... and gut microbes influence processes from digestion to disease ... most biodiverse terrestrial ecosystems on the planet, more is ... the tropics. Smithsonian scientists and colleagues working on Panama,s ... a single tree were home to more than 400 ... tree species contained more than 7,000 different kinds. , ...
Breaking Biology News(10 mins):Unraveling cell division 2Unraveling cell division 3Valencell, Inc. Selected as 'Showcase Company' at CED Tech Venture Conference 2014 2Smithsonian scientists discover tropical tree microbiome in Panama 2
... Children's Hospital of Philadelphia leads a multi-center $6.7 million ... of Mental Health (NIMH) to explore a novel approach ... studies and clinical trials in adult patients, the new ... human immunodeficiency virus: sites on immune cells known as ...
... found Envisat's MERIS sensor can detect coral bleaching ... could potentially monitor impacted coral reefs worldwide on ... symbiotic algae living in symbiosis with living coral ... expelled. The whitening coral may die with subsequent ...
... what happens in cells is the work of machines that ... human and other genomes, researchers now have a nearly complete ... manual telling where all the pieces go. A new study ... to answer this question for some of the smallest and ...
Cached Biology News:Federal grant funds research on novel HIV therapy 2Federal grant funds research on novel HIV therapy 3Health of coral reefs detected from orbit 2Many needles, many haystacks 2
(Date:9/16/2014)... -- BCC Research reveals in its new ... the global market for stem cells is expected to ... five-year compound annual growth rate (CAGR) of 13.6%. The ... growth projections of $2.2 billion in 2014 to $3.9 ... Unlike other potential applications of bioscience, stem ...
(Date:9/15/2014)... drives classical phase transitionsthink solid, liquid, and ... the temperature drops. If phase transitions occur ... mechanics reigns, subtle fluctuations can dramatically transform ... U.S. Department of Energy,s Brookhaven National Laboratory ... frigid landscape of absolute zero to isolate ...
(Date:9/15/2014)... , Sept. 15, 2014 ... on revolutionizing the treatment of cancer through the ... cells, announced that, together with the Asbestos Disease ... Cancer Institute New South Wales (NSW) Premier,s Award ... four recipients are the hospitals that will be ...
(Date:9/15/2014)... a patient has sepsis, a life-threatening condition in which ... often too fast for antibiotics to help. A new ... a team at Harvard,s Wyss Institute for Biologically Inspired ... , "Even with the best current treatments, sepsis ... 30 percent of the time," said Mike Super, Ph.D., ...
Breaking Biology Technology:Global Market for Stem Cells to Reach $10.6 Billion in 2018; The Americas Growing at 13.9% CAGR 2Global Market for Stem Cells to Reach $10.6 Billion in 2018; The Americas Growing at 13.9% CAGR 3Elusive quantum transformations found near absolute zero 2Elusive quantum transformations found near absolute zero 3EnGeneIC Named a Recipient of the Cancer Institute NSW Premier's Award for Excellence in Translational Cancer Research 2EnGeneIC Named a Recipient of the Cancer Institute NSW Premier's Award for Excellence in Translational Cancer Research 3Blood-cleansing biospleen device developed for sepsis therapy 2Blood-cleansing biospleen device developed for sepsis therapy 3Blood-cleansing biospleen device developed for sepsis therapy 4
... ... , ... Ind. (Vocus) June 17, 2009 –- Pioneer Hi-Bred , a DuPont business, ... to bring additional corn and soybean products to growers in the marketplace. Under these ...
... 17 Campbell Alliance, the leading management consulting firm ... that it has appointed industry veterans Jon W. McGarity ... gentlemen will work directly with John Campbell, CEO of ... advise the firm,s emerging and midsize client companies. ...
... QC, June 17 /PRNewswire-FirstCall/ - BioSyntech, Inc. (TSX: ... regenerative medicine, today announced statistically significant results from ... month follow-up in the BST-CarGel(R) randomized clinical trial. ... quality due to BST-CarGel treatment was found during ...
Cached Biology Technology:Pioneer Hi-Bred and Beck's Hybrids Enter into Research and Distribution Agreements 2Pioneer Hi-Bred and Beck's Hybrids Enter into Research and Distribution Agreements 3Campbell Alliance Adds Industry Veterans Jon W. McGarity and David Lilley as Executive Vice Presidents 2Campbell Alliance Adds Industry Veterans Jon W. McGarity and David Lilley as Executive Vice Presidents 3Campbell Alliance Adds Industry Veterans Jon W. McGarity and David Lilley as Executive Vice Presidents 4BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 2BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 3BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 4BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 5
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: