Navigation Links
Reportlinker Adds Biomarkers - technologies, markets and companies
Date:9/7/2010

arkers in drug safety studies 96

Genomic technologies for toxicology biomarkers 97

Proteomic technologies for toxicology biomarkers 97

Metabonomic technologies for toxicology biomarkers 98

Integration of genomic and metabonomic data to develop toxicity biomarkers 98

Toxicology studies based on biomarkers 98

Biomarkers of hepatotoxicity 99

Biomarkers of nephrotoxicity 100

Cardiotoxicity 102

Neurotoxicity 102

Applications of biomarkers for drug development 103

Application of metabonomics/metabolomics for drug development 103

Role of pharmacokinetic/pharmacodynamic biomarkers in drug development 103

Molecular imaging as a biomarker in drug development 104

Molecular imaging in preclinical studies 104

Molecular imaging in clinical trials 105

Prospects of molecular imaging in drug discovery and development 106

Biomarkers in clinical trials 106

NIH recommendations on the use of biomarkers in clinical trials 107

Advantages of biomarkers for drug development 108

Limitations and problems with use of biomarkers in clinical trials 109

Application of biomarkers by the pharmaceutical companies 109

Use of biomarkers in relation to stage of drug discovery and development 110

Drug development in cardiovascular disorders 111

Drug development in neurological disorders 111

Future prospects of biomarker-based drug development 112

The Biomarker Alliance 112

Molecular Libraries and Imaging Roadmap of NIH 112

Biomarkers Consortium 113

Pharmacogenomic biomarker information in drug labels 114

5. Role of Biomarkers in Healthcare 115

Introduction 115

Biomarkers of inflammation 115

ESR and CRP as biomarkers of inflammation 116

Biomarkers of oxidative stress 116

1,4-dihydroxynonane-mercapturic acid 116

Oxidative DNA damage 117

Proteins as bi
'/>"/>

SOURCE Reportlinker
Copyright©2010 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Related biology news :

1. Reportlinker Adds Carbon Dioxide Monitors Report
2. Reportlinker Adds World Dynamic Signature Verification Market Report
3. Reportlinker Adds Proteomics: Technologies and Global Markets Report
4. Biomarkers for identifying infant infections
5. Compendium of pancreatic cancer biomarkers established as strategic approach to early-detection
6. Prostate Cancer Translational Research in Europe meeting: Search for biomarkers continues
7. Assessing lead time of selected ovarian cancer biomarkers
8. Pacific Biometrics, Inc. Stockholders Approve Company Name Change to Pacific Biomarkers, Inc.
9. Scientists use nanosensors for first time to measure cancer biomarkers in blood
10. Pacific Biomarkers, Inc. Schedules Second Quarter Conference Call for Friday, February 12, 2010
11. New biomarkers for predicting the spread of colon cancer
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/18/2014)... and their colleagues have built the first smartphone ... performance and behavioral trends. In other words, your ... if you don,t -- and how that affects ... happiness, stress, depression and loneliness to their academic ... population for example, to monitor mental health, ...
(Date:9/18/2014)... celebrated tonight at the third annual Golden Goose Award ... premature infants and in paving the way for the ... supported by the National Science Foundation, the National Institutes ... be honored at a ceremony at the Library of ... of Congress will be on hand to help present ...
(Date:9/18/2014)... when people are too stressed they are often grouchy, ... Mind Institute (BMI) at EPFL have just highlighted a ... stress and the loss of social skills and cognitive ... synaptic regulatory molecule in the brain. This was revealed ... , Carmen Sandi,s team went to look for ...
Breaking Biology News(10 mins):New Dartmouth smartphone app reveals users' mental health, performance, behavior 2New Dartmouth smartphone app reveals users' mental health, performance, behavior 3New Dartmouth smartphone app reveals users' mental health, performance, behavior 43rd annual Golden Goose award ceremony honors 8 researchers; Unusual work had big results 2How stress tears us apart 2
... DNA is copied into ribonucleic acid (RNA) molecules, also ... making proteins, and a collection of all the transcripts ... Jaiswal, Assistant Professor of Botany and Plant Pathology at ... Jaiswal,s laboratory, and colleagues assembled transcriptomes of a noxious ...
... AMHERST, Mass. Biochemists at the University of Massachusetts ... insight into how protein synthesis and degradation help to ... they reveal how two proteins shelter each other in ... and safely. Cells must routinely dispose of leftover ...
... University of Florida paleontologists have discovered remarkably well-preserved fossils ... science during recent Panama Canal excavations that began in ... and an extinct hippo-like species inhabited Central America during ... expands the range of ancient animals in the subtropics ...
Cached Biology News:Assembling the transcriptome of a noxious weed: New resources for studying how plants invade 2New insight into double-protected dance of cell division 2UF scientists discover new crocodilian, hippo-like species from Panama 2UF scientists discover new crocodilian, hippo-like species from Panama 3
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... , ... computational drug discovery solutions provider, announced today they have licensed ... Drug Administration,s National Center for Toxicological Research (NCTR). , Under ... access to the complete TIP structural knowledgebase via ...
... , NEW ORLEANS, Dec. 8 HemaQuest Pharmaceuticals presented data ... of its lead drug candidate, HQK-1001, in sickle cell disease ... Society of Hematology in New Orleans. The preclinical studies ... of therapeutic agents that have been used in the past ...
... ... Extended Wear Hearing Aid. , ... Newark, CA (PRWEB) December 8, 2009 -- Whether it’s a crackling fire, jingling sleigh bells, ... miss out on the joyous sounds of the holidays. Lyric, the first 100% invisible ...
Cached Biology Technology:Eidogen-Sertanty Licenses TIP to the FDA 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 3Lyric Presents the Sounds of the Season 2
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: