Navigation Links
Premier issue of new Childhood Obesity journal launched by Mary Ann Liebert Inc., publishers
Date:9/7/2010

, RD; Shikha Sundaram, MD, MSCI; Angie Tagtow, MS, RD, LD;and Brian Wansink, PhD. The full editorial board is available on our website (http://www.liebertpub.com/products/eboard.aspx?pid=384).

Collaborating organizations include the American Association of Diabetes Educators, American College of Sports Medicine, American Dietetic Association, and American Academy of Family Physicians.

The premier issue includes an editorial by Regina M. Benjamin, MD, MBA, U.S. Surgeon General, and a series of eleven essays on "Childhood Obesity: How Do We Seize the Moment?" including "Stop the Blame and Start the Action: Preventing Generation Z from Becoming XXL" by Keith-Thomas Ayoob, EdD, RD, FADA; "Tobacco, Formula, and Frequent Pregnancies: The Obesity Trinity" by Melinda S. Sothern, PhD, CEP, "First Assess Then Address" by Linda Van Horn, PhD, RD, and "Restoring the Promise of a Healthy Childhood" by Sandra G. Hassink, MD, FAAP.

David Katz, MD, MPH sets the stage for the challenges ahead with a perspective piece on "It Does, Indeed, Take a Village: Schools, Families, and Beyond for Weight Control in Children." Other features include a provocative roundtable discussion on "Improving Access to Care for African-American and Latino Children and Adolescents: Barriers and Opportunities" moderated by Monica Baskin, PhD and original articles such as "Does Breastfeeding Protect Against Overweight and Obesity in Children? A Review," "Motivational Interviewing for Families with an Overweight / Obese Child," and "Making Fit Kids: The Evolution of a Hospital-Based Childhood Obesity Program in New York City."

Gail C. Christopher, DN, vice president of program strategy with the W.K. Kellogg Foundation provides a welcome for the reader and a vision for the path forward in "A New Voice Emerges in the Fight Against Childhood Obesity."

"The epidemic of childhood obesity must be
'/>"/>

Contact: Julia Chapman
jchapman@liebertpub.com
914-740-2147
Mary Ann Liebert, Inc./Genetic Engineering News
Source:Eurekalert  

Page: 1 2 3

Related biology news :

1. New ecopsychology journal will premiere in spring 2009
2. World premiere in stem cell research in Montreal
3. Premier issue of Ecopsychology launched by Mary Ann Liebert Inc. publishers
4. Elsevier pilots new research tool Reflect in its premier life science journal Cell
5. NIH awards Clemson bioengineer $1.5 million to improve durability of tissue heart valves
6. Penn biophysicists create new model for protein-cholesterol interactions in brain and muscle tissue
7. Carbon sinks: Issues, markets, policy
8. MIT: Mending broken hearts with tissue engineering
9. Human genes sing different tunes in different tissues
10. UD researchers show that plants can accumulate nanoparticles in tissues
11. Neuroinformatics special issue spotlights the Neuroscience Information Framework
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Premier issue of new Childhood Obesity journal launched by Mary Ann Liebert Inc., publishers
(Date:11/18/2014)... , Nov. 18, 2014   EyeLock Inc. ... solutions, and MorphoTrust USA (Safran), a ... today announced a strategic partnership to offer comprehensive ... vehicle administration (MVA), airport screening and financial services ... solutions, MorphoTrust serves consumers through a nationwide network ...
(Date:11/11/2014)... , Nov. 11, 2014  Forensicon, Inc., a ... firm, is pleased to announce the promotion of ... Director of Digital Forensics. In Schiff,s new role as ... the team of digital forensics examiners and provide leadership ... Photo - http://photos.prnewswire.com/prnh/20141110/157719 ...
(Date:11/7/2014)... Calif. , Nov. 7, 2014  In conjunction with ... Police Departments, The Community Foundation of the Verdugos ... DNA JUSTICE PROJECT," a $250,000 initiative to keep ... initial phase. In its first six months of existence, the ... needed evidence support for local law enforcement. "Because ...
Breaking Biology News(10 mins):EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 2EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 3Yaniv Schiff Promoted to Director of Digital Forensics at Forensicon, Inc. 2Community Foundation Of The Verdugos Unveils Campaign To Fund Glendale-Burbank DNA Justice Project 2
... February 26, 2013, New York, N.Y. and San Diego, Calif. ... tumor in adults, is challenging to treat because the tumors ... more about the causes of tumor cell growth and drug ... new targeted therapies to potentially treat this deadly cancer. ...
... 2013, Reston, VAResearchers will meet at the Society of ... a number of health concerns that have received growing ... of the presentations, scientists will explore how the development ... related exposures might affect the risk assessment of arsenic ...
... Rockville, Md. The Association for Research in Vision ... three keynote speakers, including two Nobel laureates, during the ... Wash. New this year, the ARVO/Alcon Keynote Series ... Christopher Murray, MD, DPhil. Smithies, of the University ...
Cached Biology News:Novel combination therapy shuts down escape route, killing glioblastoma tumor cells 2Scientists explore topical health issues at meeting in Texas 23 distinguished keynote speakers to present during ARVO 2013 Annual Meeting 2
(Date:11/22/2014)... 21, 2014   ... Commercial Officer zu KLOX    ... Chief Financial Officer bestellt    KLOX ... seines jüngst zugelassenen Behandlungssystems zur Wundheilung zu beginnen    ... "Unternehmen") ist sehr erfreut, die folgenden personellen Veränderungen anzukündigen: ...
(Date:11/21/2014)... BELLINGHAM, Washington, USA (PRWEB) November 19, 2014 ... used in our lives was shared with more than ... undergraduate and postgraduate students from the University of Otago ... Outreach Grant . The Otago students, members of the ... Southland New Zealand in early September, giving children from ...
(Date:11/21/2014)... 20, 2014 The California ... research organization representing leading California academic institutions, biotechnology, ... PwC US today released a report revealing ... industry growth. The trend shows a 4 percent ... California Biomedical Industry Report indicates that, while ...
(Date:11/21/2014)... Fayetteville, Arkansas (PRWEB) November 20, 2014 ... partners, Pinnacle Ozone Solutions, LLC (Pinnacle), and PCI, ... equipment, announced that they have been selected to ... City of Fayetteville, Arkansas Paul R. Noland Wastewater ... feature BlueInGreen’s patented HyDOZ® gas dissolution ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Optics and photonics outreach programs share science, spark fascination with light 2Optics and photonics outreach programs share science, spark fascination with light 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 2California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 4City of Fayetteville Leads Nation with Innovative Ozone Technology 2City of Fayetteville Leads Nation with Innovative Ozone Technology 3City of Fayetteville Leads Nation with Innovative Ozone Technology 4
... veteran, was promoted to president of the General Electric Medical ... who left to become CEO at Invitrogen. The division focuses ... systems . , ,It's a dream job for a corporate ... about $9 billion and produced GE CEO and Chairman Jeffery ...
... develops and sells employee scheduling and management products. The ... and co-founder of Suite Scheduler, a former nurse manager ... employees in a facility. , ,Suite Scheduler products are ... up to 90% of the time to create and ...
... That is, until he gets to the better drugs, faster ... the science behind the Madison-based companys products is likely to ... nears the age when diseases and treatments become as common ... the two and a half-year-old company that Vodenlich joined as ...
Cached Biology Technology:CEO Wilson Defines GE's Health-IT Customer 2CEO Wilson Defines GE's Health-IT Customer 3CEO Wilson Defines GE's Health-IT Customer 4Scheduling made easy with Suite Scheduler 2Scheduling made easy with Suite Scheduler 3Chipping Away at Drug Development 2Chipping Away at Drug Development 3
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products: