Navigation Links
Potential new heart attack biomarker uncovered
Date:12/10/2009

Though they remain a leading killer, heart attacks can be effectively treated provided they can be rapidly diagnosed following initial onset of symptoms. In a study appearing in this month's Molecular and Cellular Proteomics, researchers have identified cardiac myosin-binding protein C (cMyBP-C) as a potential new diagnostic biomarker for heart attacks, one that may be particularly valuable for mild attacks in which traditional diagnostic proteins may not be abundant enough.

Currently, one of the gold-standards for diagnosis of heart attacks, or acute myocardial infarctions, is scanning for the presence of the proteins troponin I and troponin T, as they are produced specifically in the heart and are almost completely absent in the blood in healthy individuals.

However, even troponins are not ideal markers, since they are released somewhat slowly following a heart attack (peaking around 18 hours post-infarction) and remain in the blood for up to 10 days afterwards, hindering the diagnosis of any secondary heart attacks.

In the quest for better biomarkers, a group of researchers at King's College London performed a proteomic analysis of all the proteins released by mouse hearts following induced heart attacks. They identified 320 proteins not released by normal hearts, including all the currently employed biomarkers.

Only a handful of these proteins were specific to the heart, but among those, one very promising lead was cMyBP-C; within 5 minutes following a heart attack it became nearly 20 fold more abundant than before, one of the highest increases of all 320 identified proteins. In fact, cMyBP-C was abundant following even minor heart attacks, suggesting it could be very useful in such instances.

The researchers are now continuing their investigation and examining the time course of cMyBP-C release following heart attacks and its persistence in the blood of mice, to further determine this protein's poten
'/>"/>

Contact: Nick Zagorski
nzagorski@asbmb.org
301-634-7366
American Society for Biochemistry and Molecular Biology
Source:Eurekalert

Page: 1 2

Related biology news :

1. Potential cancer drug may offer new hope for asthma patients
2. New research provides insights into potential ecological costs and cobenefits of REDD
3. Interactions with aerosols boost warming potential of some gases
4. LX211 highlighted as potential disease modifying therapy for non-infectious uveitis
5. Heat forms potentially harmful substance in high-fructose corn syrup
6. Iowa State University researcher uncovers potential key to curing tuberculosis
7. Mechanism for potential Friedreichs ataxia drug uncovered
8. The vasculature emerges as a potential therapeutic target in treating ADPKD liver cysts
9. National new biology initiative offers potential for remarkable and far-reaching benefits
10. Fear of insurance rejection deters potentially life saving genetic tests for bowel cancer
11. Time to tap climate change-combating potential of the worlds ecosystems
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/19/2013)... MOUNTAIN VIEW, Calif. , June 20, 2013 ... the personalized cosmeceuticals market, Frost & Sullivan recognizes ... Sullivan Award for New Product Innovation. geneOnyx leverages ... point-of-care testing to create an on-the-spot genetic test ... only a single-step DNA collection procedure from saliva ...
(Date:6/19/2013)... is playing a vital role in the survival of ... to climate and environmental changes, according to new research ... savannah birds from the Tanzanian Bird Atlas project - ... - the researchers found that they are using protected ... further west where dry seasons are getting longer, with ...
(Date:6/19/2013)... 19, 2013   Mercy Medical Center ... technology for conducting on-demand, Hemoglobin A 1c ... well as analysis of important red blood ... The new system enables the hospital to ... physicians and their patients, which can improve ...
Breaking Biology News(10 mins):Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 2Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 3Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 4Protected areas provide African birds with stepping stones to survival 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 3Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 4
... in biomedical science are on the horizon with ... Infrastructure (Instruct) in support of European biomedical research. ... (ESFRI) is involved in establishing about 40 such ... is one such biomedical project, whose aim is ...
... center responsible for responding goes into gear, setting off a ... from the adrenal glands. Dr. Gil Levkowitz ... now revealed a new kind of ON-OFF switch in the ... from the brain that stimulates cortisol release in the body. ...
... by a University of California, Davis, plant scientist delivers a ... world-renowned wine industry. The study is set for publication ... the Proceedings of the National Academy of Sciences. "Many ... plant, but we believe that most microbes would have difficulty ...
Cached Biology News:European Integrated Structural Biology Infrastructure launching 2A unique on-off switch for hormone production 2Fused genes tackle deadly Pierce's disease in grapevines 2
(Date:6/19/2013)... 20, 2013 New programme ... solutions for pharmaceutical and chemical sectors ... Pte. Ltd. and Siemens Pte. Ltd, have signed ... R&D Consortium Programme - Innovative Processing of Specialties ... Chemical and Engineering Sciences (ICES), the consortium offers ...
(Date:6/19/2013)... 2013 For an eco-friendly selection for ... Baths using metallic beads instead of water. The ... not require germicides. Yet, the bead bath delivers exceptional ... is always ready unlike a water bath, no warm-up ... bath, which eliminates the contamination and maintenance issues related ...
(Date:6/19/2013)... Bellevue, WA (PRWEB) June 19, 2013 ... open an exhibit hall of technology solutions for ... 6:30pm at the Hyatt Regency Bellevue. , ... to the public on Saturday and Sunday, will ... which includes power wheelchairs, communication devices, eyegaze technologies, ...
(Date:6/19/2013)... Miami, FL (PRWEB) June 19, 2013 An ... shed light on the increasing number of uses for probiotics. ... have probiotic qualities, and the associate benefits may beeb listed, ... health, reducing inflammation, and helping clear skin conditions. While the ... News shed light on the the uses of these “miracle” ...
Breaking Biology Technology:Pfizer, GSK, and Siemens Form R&D Consortium With A*STAR's Institute of Chemical & Engineering Sciences 2Pfizer, GSK, and Siemens Form R&D Consortium With A*STAR's Institute of Chemical & Engineering Sciences 3Pfizer, GSK, and Siemens Form R&D Consortium With A*STAR's Institute of Chemical & Engineering Sciences 4Cole-Parmer Introduces Eco-Friendly Waterless Bead Baths 2City of Bellevue, Wash., Welcomes Assistive Technology Exhibit Hall 2Natural Acne Remedy, Probiotic Action Explains the Science behind Using Probiotics for Better Health 2
... MOUNTAIN VIEW, Calif., Jan. 17, 2012  MAP Pharmaceuticals, Inc. (Nasdaq: ... James O,Shea to its Board of Directors. Mr. O,Shea brings ... product commercialization and operations. "We are privileged to ... time in the Company,s development as we focus our efforts ...
... 16, 2012 Luminex Corporation (Nasdaq: LMNX ) ... fourth quarter and full year 2011 on Monday, February 6, ... release after the close of trading. (Logo: ... conference call to discuss the operating highlights and financial results ...
... 2012 Elsevier, a world-leading provider ... services, announced today that its first bilingual platform of ... , is now available online. NursingChina ... available in China, featuring skills within specialties such ...
Cached Biology Technology:MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 2MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 3Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 2Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 3Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 2Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 3
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: