Navigation Links
Positive results in Phase 2 trial of treatment of C-difficile-associated diarrhea
Date:11/3/2008

Princeton, N.J. and Jamaica Plain, Mass., November 3, 2008 Medarex, Inc. (Nasdaq: MEDX) and The Massachusetts Biologic Laboratories (MBL) of the University of Massachusetts Medical School (UMMS) today announced that a Phase 2 trial of an anti-C. difficile antibody combination treatment in patients with C. difficile Associated Diarrhea (CDAD) successfully met its primary objective. The top-line results from the recently completed multi-center, randomized, double-blind, placebo-controlled Phase 2 trial indicated a statistically significant reduction in recurrences of CDAD when compared with placebo. In the study, 200 patients symptomatic with CDAD receiving standard of care antibiotics (metronidazole or vancomycin) were randomized to receive either intravenous placebo or intravenous administration of a combination of MDX-066 (CDA-1) and MDX-1388 (CDB-1), two fully human antibodies that neutralize C. difficile toxins A and B, respectively.

Consistent with the published literature, the recurrence rate in the placebo-treated group exceeded 20 percent for patients following successful treatment with standard of care antibiotics. In comparison with placebo, MDX-066/MDX-1388 treatment reduced recurrence rates by approximately 70 percent (p=0.0004 on the intent-to-treat population). The antibody combination treatment was generally safe and well-tolerated. Full results from this Phase 2 trial are planned to be presented at a future scientific meeting.

The incidence and mortality associated with CDAD has been increasing , with estimates of over 500,000 cases in the United States, and approximately 15,000 deaths caused or contributed by C. difficile. The emergence of a highly virulent epidemic strain that produces much higher levels of toxins A and B has also been associated with morbidity and mortality in younger, healthier, and non-hospitalized patients.

"We are delighted with these dramatic results. CDAD is a gr
'/>"/>

Contact: Michael Cohen
michael.cohen@umassmed.edu
508-868-4778
University of Massachusetts Medical School
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. Oral rinses used for tracking HPV-positive head and neck cancers holds promise for cancer screening
2. Vaccine against HER2-positive breast cancer offers complete protection in lab
3. Dry Tortugas show positive trends: Protected area slowly rebounding
4. Men unaware of their cancer risk when female relatives test positive for BRCA mutation
5. HGS announces positive Phase 2 LymphoStat-B at ACR meeting
6. Positive results for airway bypass
7. First results from hospital trials testing
8. Communication Intelligence Corporation Reports Third Quarter 2008 Financial Results
9. Synaptics Reports Record Results for First Quarter of Fiscal 2009
10. Synaptics to Report First Quarter Results on October 23
11. Prosthetic vein valve designed to direct blood flow shows promising pre-clinical results
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
(Date:12/19/2014)... The empty capsules market is experiencing ... and technological innovations in the empty capsules market. ... the growth of the empty capsules market. , ... Scope of Report , The report will enrich ... firms to gauge the pulse of the market ...
(Date:12/19/2014)... -- Relmada Therapeutics, Inc. (OTCQB: RLMD), a clinical-stage company ... announced the results of its annual general meeting of ... year in Relmada,s history and it set the stage ... Sergio Traversa , chief executive officer of Relmada. "Over ... human resource and clinical development objectives that position Relmada ...
(Date:12/17/2014)... BASKING RIDGE, N.J. (PRWEB) December 17, 2014 ... Ipsen (Euronext: IPN; ADR: IPSEY), ... 120 mg (referred to as Somatuline®) was approved ... for the treatment of gastroenteropancreatic neuroendocrine tumors (GEP-NETs) ... differentiated, locally advanced or metastatic disease to improve ...
(Date:12/17/2014)... Audacity, a leading California-based health and ... the Huntsworth Health Group, is proud to announce the ... her role, Gonzales will serve as Senior Vice President ... to welcome a talent of Jamie’s caliber to the ... “She is a proven healthcare innovation leader and brand ...
Breaking Biology Technology:Empty Capsules Market Hit to Reach $1,820 Million by 2019 - New Research Report by MarketsandMarkets 2Empty Capsules Market Hit to Reach $1,820 Million by 2019 - New Research Report by MarketsandMarkets 3Empty Capsules Market Hit to Reach $1,820 Million by 2019 - New Research Report by MarketsandMarkets 4Relmada Therapeutics Announces Results of Annual Shareholders Meeting 2Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 2Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 3Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 4Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 5Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 6Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 7Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 8Audacity Welcomes Healthcare Communications Expert Jamie Gonzales as Senior Vice President of Client Services 2
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: