Navigation Links
Pores finding reveals targets for cancer and degenerative disease
Date:12/18/2009

Walter and Eliza Hall Institute scientists have identified a key step in the biological process of programmed cell death, also called apoptosis.

Apoptosis is important in human biology as it removes unwanted and sometimes dangerous cells from our bodies, protecting us against cancer development. It can also, however, lead to the development of degenerative diseases when healthy cells are errantly destroyed.

The research, led by Dr Ruth Kluck from the institute's Molecular Genetics of Cancer Division, is crucial to the development of drugs that can turn on apoptosis, thereby more effectively killing cancer cells. It could also be used in developing compounds that turn off the apoptosis that leads to degenerative disorders.

Dr Kluck has been investigating the role in apoptosis of two proteins, Bak and Bax. It is thought that understanding their role will identify targets against which drugs to regulate cell death could be designed.

"The pivotal step towards cell death is the formation of a pore in the mitochondria; mitochondria make and supply energy to the cells," Dr Kluck said. "Pore formation is the point of no return in apoptotic cell death as it allows cytochrome c, which is the protein that initiates cell death, to escape from the mitochondria. Only two proteins are known to form the pore, Bak and Bax."

In 2008 Dr Kluck and her colleagues published their finding that, in order to form the pore, Bak first changes shape and then combines with another Bak protein to form a doublet.

"We have now identified the second step in how Bak forms that pore," Dr Kluck said. "Once the doublet is formed it can combine with other Bak doublets by what's called a second interface. This second interface seems to allow doublets to assemble into the larger complexes that form the pore."

The team of Dr Kluck, Dr Grant Dewson, Mr Tobias Kratina, Dr Peter Czabotar and Professor Jerry Adams from the institute and Dr
'/>"/>

Contact: Penny Fannin
fannin@wehi.edu.au
61-393-452-345
Walter and Eliza Hall Institute
Source:Eurekalert  

Page: 1 2

Related biology news :

1. Pores open the door to death
2. In many fungi, reproductive spores are remarkably aerodynamic
3. C. difficile spores spread superbug
4. Finding that 1-in-a-billion that could lead to disease
5. First finding of a metabolite in 1 sex only
6. Embryonic stem cell strategy advanced with UCSF finding
7. New prostate cancer research findings
8. Reprogramming the debate: stem-cell finding alters ethical controversy
9. Lupus gene finding prompts call for more DNA samples
10. K-State researchers findings on E. coli
11. UVA reports surprising findings related to myotonic muscular dystrophy
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Pores finding reveals targets for cancer and degenerative disease
(Date:12/24/2014)... its launch in December 2014, the 1U™ app ... trying to remember their usernames and passwords through replacing the ... To assist people who have struggled to remember usernames and ... and focuses on redefining identity, announced today that it is ...
(Date:12/22/2014)... DUBLIN , Dec. 22, 2014 Research and ... the addition of the "The Global Watermarking ... http://photos.prnewswire.com/prnh/20130307/600769 ... global digital media watermarking and fingerprinting markets. Watermarking ...
(Date:12/19/2014)... , Dec. 18, 2014 Research and Markets ... "iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & ... http://photos.prnewswire.com/prnh/20130307/600769 ... introduced the fingerprint reading feature with the iPhone 5S. ...
Breaking Biology News(10 mins):1U Offers Best Solution to the Username / Password Dilemma: For FREE! 21U Offers Best Solution to the Username / Password Dilemma: For FREE! 3The Global Watermarking and Fingerprinting Markets 2iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & Sapphire - Technology Report 2
... in a group of heat-loving bacteria by researchers at ... light a fire under next-generation biofuel production. Scientists ... to break down complex plant material such as switchgrass ... make biofuels. Conventional processes involve the addition of commercially ...
... faded since the end of the Cold War, existing ... devastating global impacts. Researchers at the University of ... effects of a hypothetical nuclear war between India and ... in distant countries. The work, by Mutlu Ozdogan ...
... in our bodies. This process is driven by microtubule filaments ... so-called motor proteins in the cytosol can control their dynamics. ... of cell division. It is composed in large part of ... size, shape and mobility of a cell. In a new ...
Cached Biology News:BESC researchers tap into genetic reservoir of heat-loving bacteria 2War-related climate change would reduce substantially reduce crop yields 2
(Date:1/22/2015)... 2015 Protocol Networks brings independent technology ... of brand-neutral, independent consultants, Protocol Networks has recently announced ... over the years, his company has attracted several clients ... Plainfield, as well as others. With the success of ...
(Date:1/22/2015)... Pipette.com has added the Eppendorf ... portfolio of Eppendorf products. , The Eppendorf Centrifuge 5424/5424 ... 5424/5424 R and receive the following:, , ... or Eppendorf Reference 2 ,     3 Free ...
(Date:1/22/2015)... Madison, WI (PRWEB) January 22, 2015 Dr. ... at the 12th annual Scripps Natural Supplements Pre-Conference seminar on ... Supplements Conference is an annual continuing education conference for health ... 15th and included the topic of probiotics in health. Dr. ...
(Date:1/22/2015)... January 22, 2015 Selexis SA, a ... Research Cell Banks (RCBs) used for drug discovery to ... Banks will include Next-Generation Sequencing (NGS) data ... de-risks biologic manufacturing by ensuring the integrity of the ...
Breaking Biology Technology:Protocol Networks Brings Independent Technology Consulting to the Constitution State 2Eppendorf Announces Promotional Bundle Which Includes: Eppendorf Centrifuge 5424, 3-Pack of Pipettes, and Tips - Available Now at Pipette.com 2Selexis Generated Research Cell Banks Now Fully Sequenced Using Next-Generation Sequencing 2
... AUSTIN, Texas and TORONTO, Oct. 3 Two ... to integrate vibration,therapy into the stem cell harvesting ... company based in Austin,Texas, has signed an exclusive ... of Toronto, Ontario. The partnership,between the two companies ...
... ),AMDL, Inc. (Amex: ADL ), a leading vertically ... US, today announced that the,Company will present at the ... Tuesday, October 7, 2008 at 10:30 a.m. ET. AMDL,s ... Hotel in the Morosco Room., The Maxim Group ...
... Stock Exchange Symbol: MS, EDMONTON, Oct. 3 ... developer in the treatment of multiple sclerosis (MS), ... (DSMB) for the,Company,s U.S. pivotal phase III MAESTRO-03 ... MS has completed a safety analysis,and recommended that ...
Cached Biology Technology:New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 2New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 3AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 2AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 3BioMS Medical's phase III U.S. multiple sclerosis trial receives positive safety review from Data Safety Monitoring Board 2
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Biology Products: