Navigation Links
Plant breeding revolution for cassava, banana
Date:9/14/2011

Cassava, banana and plantain, staple foods for millions of the world's poorest people, are notoriously difficult to breed. But an international team of scientists aims to change that, using a revolutionary new approach to plant breeding developed at the University of California, Davis.

The project is supported by a grant of $1.2 million from the NSF-BREAD (Basic Research to Enable Agricultural Development) program, a joint initiative of the Bill & Melinda Gates Foundation and the National Science Foundation.

"These are very important food security crops, but they take a long time to reproduce and it's difficult to create new varieties," said Simon Chan, assistant professor of plant biology at UC Davis.

Recently Chan and the other team members Hernan Ceballos, of the International Center for Tropical Agriculture in Cali, Colombia; Jim Lorenzen, from the International Institute of Tropical Agriculture in Tanzania; and Leena Tripathi of the International Institute for Tropical Agriculture in Nairobi, Kenya were invited, with other recipients of NSF-BREAD grants, to present their work to Bill Gates at the foundation's headquarters in Seattle.

"He was very interested in the science and had good questions for everyone," Chan said.

Most successful crop varieties are hybrids created by crossing two inbred varieties. While this is relatively easy to do in well-established annual crops like maize or wheat, it is much harder with slower-growing crops like cassava, banana and plantain. As a result, cassava, banana and plantain growers are currently forced to create new varieties by crossing two hybrid parents a highly unpredictable process.

New crop varieties allow farmers to cope with pests, disease, drought and other problems.

Working with the small laboratory plant Arabidopsis thaliana, Chan's lab recently discovered a method to create plant seeds that carry the DNA from only one of their parents, allowin
'/>"/>

Contact: Andy Fell
ahfell@ucdavis.edu
530-752-4533
University of California - Davis
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. New technique elucidates dynamics of plant cell metabolites
2. Plant compound reduces breast cancer mortality
3. The breathtaking dance of plants
4. Bird pollinated plant mixes it up when it comes to sex
5. Manipulating plants circadian clock may make all-season crops possible
6. Mapping a model: International research on plant species appears in journal Nature
7. How an evolutionary playground brings plant genes together
8. Little plant tells big stories
9. NASA study refutes claims of drought-driven declines in plant productivity, global food security
10. Molecular chaperones traffic signaling proteins between cells in plant stem-cell maintenance pathway
11. UC Riverside plant biotechnologist receives prestigious Jefferson Science Fellowship
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/24/2014)... its launch in December 2014, the 1U™ app ... trying to remember their usernames and passwords through replacing the ... To assist people who have struggled to remember usernames and ... and focuses on redefining identity, announced today that it is ...
(Date:12/22/2014)... DUBLIN , Dec. 22, 2014 Research and ... the addition of the "The Global Watermarking ... http://photos.prnewswire.com/prnh/20130307/600769 ... global digital media watermarking and fingerprinting markets. Watermarking ...
(Date:12/19/2014)... , Dec. 18, 2014 Research and Markets ... "iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & ... http://photos.prnewswire.com/prnh/20130307/600769 ... introduced the fingerprint reading feature with the iPhone 5S. ...
Breaking Biology News(10 mins):1U Offers Best Solution to the Username / Password Dilemma: For FREE! 21U Offers Best Solution to the Username / Password Dilemma: For FREE! 3The Global Watermarking and Fingerprinting Markets 2iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & Sapphire - Technology Report 2
... in a group of heat-loving bacteria by researchers at ... light a fire under next-generation biofuel production. Scientists ... to break down complex plant material such as switchgrass ... make biofuels. Conventional processes involve the addition of commercially ...
... faded since the end of the Cold War, existing ... devastating global impacts. Researchers at the University of ... effects of a hypothetical nuclear war between India and ... in distant countries. The work, by Mutlu Ozdogan ...
... in our bodies. This process is driven by microtubule filaments ... so-called motor proteins in the cytosol can control their dynamics. ... of cell division. It is composed in large part of ... size, shape and mobility of a cell. In a new ...
Cached Biology News:BESC researchers tap into genetic reservoir of heat-loving bacteria 2War-related climate change would reduce substantially reduce crop yields 2
(Date:1/22/2015)... 2015 Protocol Networks brings independent technology ... of brand-neutral, independent consultants, Protocol Networks has recently announced ... over the years, his company has attracted several clients ... Plainfield, as well as others. With the success of ...
(Date:1/22/2015)... Pipette.com has added the Eppendorf ... portfolio of Eppendorf products. , The Eppendorf Centrifuge 5424/5424 ... 5424/5424 R and receive the following:, , ... or Eppendorf Reference 2 ,     3 Free ...
(Date:1/22/2015)... Madison, WI (PRWEB) January 22, 2015 Dr. ... at the 12th annual Scripps Natural Supplements Pre-Conference seminar on ... Supplements Conference is an annual continuing education conference for health ... 15th and included the topic of probiotics in health. Dr. ...
(Date:1/22/2015)... January 22, 2015 Selexis SA, a ... Research Cell Banks (RCBs) used for drug discovery to ... Banks will include Next-Generation Sequencing (NGS) data ... de-risks biologic manufacturing by ensuring the integrity of the ...
Breaking Biology Technology:Protocol Networks Brings Independent Technology Consulting to the Constitution State 2Eppendorf Announces Promotional Bundle Which Includes: Eppendorf Centrifuge 5424, 3-Pack of Pipettes, and Tips - Available Now at Pipette.com 2Selexis Generated Research Cell Banks Now Fully Sequenced Using Next-Generation Sequencing 2
... AUSTIN, Texas and TORONTO, Oct. 3 Two ... to integrate vibration,therapy into the stem cell harvesting ... company based in Austin,Texas, has signed an exclusive ... of Toronto, Ontario. The partnership,between the two companies ...
... ),AMDL, Inc. (Amex: ADL ), a leading vertically ... US, today announced that the,Company will present at the ... Tuesday, October 7, 2008 at 10:30 a.m. ET. AMDL,s ... Hotel in the Morosco Room., The Maxim Group ...
... Stock Exchange Symbol: MS, EDMONTON, Oct. 3 ... developer in the treatment of multiple sclerosis (MS), ... (DSMB) for the,Company,s U.S. pivotal phase III MAESTRO-03 ... MS has completed a safety analysis,and recommended that ...
Cached Biology Technology:New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 2New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 3AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 2AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 3BioMS Medical's phase III U.S. multiple sclerosis trial receives positive safety review from Data Safety Monitoring Board 2
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Biology Products: