Navigation Links
Pfizer supports open access publishing for researchers in low-income countries
Date:5/5/2009

Today, Pfizer announced an agreement with BioMed Central to launch an open access waiver fund which will support automatic waivers of publication fees for authors from low-income countries.

Thanks to the open access waiver fund, researchers in low-income countries can publish research articles in BioMed Central's open access journals without the need to pay a publication fee.

Speaking of the agreement Dr Jack Watters, Vice President, Pfizer External Medical Affairs said "Pfizer's support for open access publishing is driven by a recognition of the wide benefits of global access to the latest research results, and the crucial role that open access journals can play in the communication of those results. In addition, we feel that it is critically important that the benefits of scientific publication are extended to all scientists who do quality research, and that providing this access will promote much-needed recognition of research conducted in developing countries.

Matthew Cockerill, BioMed Central's Managing Director, commented: "Researchers working in low-income countries have been strong supporters of open access publishing. Many of BioMed Central's most successful journals such as Malaria Journal and BMC Public Health, focus on issues of strong relevance to developing countries and publish many articles from these countries. BioMed Central's policy of automatic waivers for low-income countries ensures that researchers based in these countries will face no financial barrier to publishing and sharing their work in a way that makes it globally accessible."


'/>"/>

Contact: Matt McKay
matthew.mckay@biomedcentral.com
44-020-319-22216
BioMed Central
Source:Eurekalert

Page: 1

Related biology news :

1. Pfizer inks global license to Genomatix Software and databases
2. Scripps Research discovery leads to broad potential applications in CovX-Pfizer deal
3. $10 million Simons Foundation gift supports new initiative with Institute for Advanced Study
4. Lancet study supports new, highly effective treatment for blood disorder
5. Research supports toxoplasmosis link to schizophrenia
6. VCU survey: US public supports genetic research, testing and government spending on research
7. Synthetic virus supports a bat origin for SARS
8. The MDS foundation supports vidazas recommendation for European approval
9. The MDS Foundation supports the FDAs decision to expand vidaza label to include survival data
10. New book further supports controversial theory of Man the Hunted
11. Grant supports emerging field of massive data analysis and visual analytics
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/16/2009)... of microfossils found in ocean sediment cores is illuminating ... a critical period of Earth history. , Around 55 ... epoch, the Earth,s poles are believed to have been ... 25 million years later, ice sheets covered Antarctica and ... change from greenhouse to icehouse conditions resulted from decreasing ...
(Date:12/16/2009)... DC US Secretary of Energy Steven Chu announced ... for their outstanding contributions in research and development supporting ... six winners named today will receive a gold medal, ... honored at a ceremony in Washington, DC early next ... the national, economic and energy security of the United ...
(Date:12/16/2009)... get psyched up for contests, but when these rituals ... down before and during events, they could be causing ... for the symptoms of an injury, not the injury ... focuses on musculoskeletal health and sports medicine. "They may ... certain level, but pain occurs for a reason. It ...
Breaking Biology News(10 mins):From greenhouse to icehouse -- reconstructing the environment of the Voring Plateau 2Secretary Chu announces 2009 Ernest Orlando Lawrence Award winners 2NSAIDs: Take 'em early and often when competing? Think again 2Neuropathic pain 3A The sea provides a new hope of relief 9475 1Neuropathic pain 3A The sea provides a new hope of relief 9475 2100+ Nurses to Rally in SF Wed to Demand Stronger Swine Flu Safety Protections 3A California Hospitals Remain Unprepared Despite First Nurse Death 53680 1100+ Nurses to Rally in SF Wed to Demand Stronger Swine Flu Safety Protections 3A California Hospitals Remain Unprepared Despite First Nurse Death 53680 2100+ Nurses to Rally in SF Wed to Demand Stronger Swine Flu Safety Protections 3A California Hospitals Remain Unprepared Despite First Nurse Death 53680 3Pharmacy Compounds Liquid Mupirocin for the Chronic Sinusitis Patient 13365 1Pharmacy Compounds Liquid Mupirocin for the Chronic Sinusitis Patient 13365 2
... SAN FRANCISCO, CA June 16, 2008 --- iZumi ... independent non-profit biomedical research organization, have announced a major ... for induced pluripotent stem (iPS) cells. , iPS ... and potential to those of human embryonic stem (ES) ...
... 2008, BETHESDA, MD The March of Dimes has ... and will work to address preterm birth globally. The ... of Preterm Birth, supports the national action plan being ... growing crisis of preterm birth. , "The March of ...
... Old muscle got a shot of youthful vigor in a ... Berkeley, setting the path for research on new treatments for ... Parkinson,s diseases. , In a new study to be published ... Nature , researchers identified two key regulatory pathways that ...
Other Biology News:March of Dimes announces Prematurity Campaign expansion at Surgeon General's conference 2March of Dimes announces Prematurity Campaign expansion at Surgeon General's conference 3Stem cell researchers give old muscle new pep 2Stem cell researchers give old muscle new pep 3Stem cell researchers give old muscle new pep 4
(Date:12/17/2009)... Rx Club, the Daveys, the GLOBALS, ,and PM360 Pharma Choice ... ... 17, 2009 -- Chicago-based full-service healthcare communications agency Goble & ... awards programs honoring exceptional creative and interactive work. , , ... with 9 Awards of Excellence for the following creative work: ...
(Date:12/16/2009)... cheap, accurate test to find undetected landmines. , Students ... bacteria that glows green when it comes into contact ... can be mixed into a colourless solution that, when ... indicate the presence of landmines. , Researchers say ... be delivered from the air onto areas thought to ...
(Date:12/16/2009)... Technological University (NTU) signed the Memorandum of Understanding ... Research (CNRS) and the Thales Group of Companies ... three parties are meeting again in Singapore to ... NTU. , Located at the Research Techno ... latest in science and technology to develop innovations ...
(Date:12/16/2009)... microgears in suspended solution by swimming , ... ... Scientists at the U.S. Department of Energy’s (DOE) Argonne National ... bacteria can turn microgears when suspended in a solution, providing ... , , ,“The gears are a million times more massive ...
Breaking Biology Technology:Goble & Associates Creative Work Awarded at Advertising Industry Competitions 2Goble & Associates Creative Work Awarded at Advertising Industry Competitions 3Goble & Associates Creative Work Awarded at Advertising Industry Competitions 4New Singapore-French nanotech lab opens at NTU 2New Singapore-French nanotech lab opens at NTU 3Argonne Scientists Use Bacteria to Power Simple Machines 2Argonne Scientists Use Bacteria to Power Simple Machines 3
... CHICAGO, Dec. 14 Non-surgical, spinal decompression is,probably ... need. And you can,forget about popping toxic pills, ... this amazing technology - for most people - ... Thea Flock is Chicagoland,s most respected authority on ...
... 13 Give the person on your list who,has ... of a Magical Mystical,Pen by world-renowned artist, Karen Sperling., ... Magical Mystical Tour,abstracts, currently exhibited in the Digital Long ... in St. James, NY, through,January 11, 2008., "Karen ...
... presented at San Antonio Breast Cancer Symposium, ... in the rapidly evolving field of molecular diagnostics, ... the,prognostic power of its MammaPrint(R) breast cancer prognosis ... The data show that,MammaPrint(R) can accurately identify a ...
Other Biology Technology:Amazing Treatment Relieves Serious Back Pain Without Dangerous Drugs, Injections or Surgery! 2Artistic Magical Mystical Tours 2MammaPrint(R) Breast Cancer Test Validated in Lymph Node-Positive Breast Cancer Patients 2MammaPrint(R) Breast Cancer Test Validated in Lymph Node-Positive Breast Cancer Patients 3
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Biology Products: