Navigation Links
Parkinson's Surgery Research wins NSF Grant
Date:10/1/2013

A researcher with the University of Houston Cullen College of Engineering has won a grant to make brain surgery for patients with severe cases of Parkinson's disease safer and more effective.

The grant goes to Nuri Ince, an assistant professor of biomedical engineering. Awarded by the National Science Foundation, it is valued at $330,000 for three years of work.

Ince, in collaboration with Aviva Abosch, an M.D./Ph.D a neurosurgeon with the University of Colorado School of Medicine, will use the funds to improve deep brain stimulation (DBS) surgery.

In this surgery, an electrode measuring just a few millimeters across is inserted into the brain. When attached to a small battery pack, a series of contacts on the electrode can be used to both stimulate and record electrical activity in nearby neurons.

The target of the probe is the subthalamic nucleus (STN), a small, football-shaped section of the brain that helps control movement. In Parkinson's patients, the STN is misfiring, causing symptoms like tremors and labored movement. For most patients, these symptoms can be managed by medication. Some, though, don't respond to medicine. If their symptoms become severe enough, they may opt for DBS surgery.

One of the major challenges in DBS surgery is getting the electrode to just the right spot. The STN sits nearly 3 inches below the scalp and is very tiny just 6 millimeters by 4 millimeters. This makes hitting the STN with the probe extremely difficult, Ince said. And that's the exact problem he aims to solve.

Currently, surgeons insert several microelectrodes into the brain in order to record electrical activity that hopefully will reveal the STN's location. It is very difficult, though, for neurosurgeons to interpret this activity, especially during an actual surgery.

It also neglects the abilities of the probe that targets the STN, Ince said. The contacts on this probe can not only stimulate electrical
'/>"/>

Contact: Jeannie Kever
jekever@uh.edu
713-743-0778
University of Houston
Source:Eurekalert

Page: 1 2

Related biology news :

1. Breast cancer surgery linked to swollen arm syndrome
2. Chris Christie, Governor of New Jersey, Slims Down after Having Lap Band Surgery
3. Research shows Vitamin D levels drop after pediatric heart surgery, increasing sickness
4. Improved material for laser welding of tissue in intestinal surgery
5. Study finds possible alternative to bariatric weight loss surgery
6. What you eat before surgery may affect your recovery
7. Physical activity linked to lower rates of depression in bariatric surgery patients
8. Mussels inspire innovative new adhesive for surgery
9. Small Animal Soft Tissue Surgery, (with DVD-ROM)
10. Vaccine offers promise as post-surgery treatment for pancreatic cancer patients
11. Seizures linked to surgery drugs can be prevented by anesthetics, U of T team finds
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
(Date:12/19/2014)... N.Y. , Dec. 18, 2014 Egenix, Inc. ... has been elected Chairman of the Board, to succeed ... and CEO, but will continue as a member of the ... he has added to the company over almost twenty years, ... The Board of Directors has established a Search Committee ...
(Date:12/17/2014)... USA (PRWEB) December 16, 2014 ... manager at Philipps- Universität Marburg’s Department of Physics, ... photonics, in the newly released SPIE Women ... never be too shy to ask questions.” , ... technology, engineering, and mathematics) occupations ranging from university ...
(Date:12/17/2014)... Xeno Diagnostics has again received ... recent COLA inspection. Xeno has met all criteria ... accreditation organization. Accreditation is earned only by laboratories ... operations, demonstrate continued accuracy in the performance of ... survey. , While the Laboratory Excellence ...
(Date:12/17/2014)... Md. , Dec. 17, 2014 CASI ... company dedicated to the acquisition, development and commercialization of ... for the global market with a primary commercial focus ... it has been granted a Type C meeting with ... the meeting will be held in February 2015.  During ...
Breaking Biology Technology:Network, Multitask, Persevere: SPIE Women in Optics Planner Subjects Share from Experience 2Network, Multitask, Persevere: SPIE Women in Optics Planner Subjects Share from Experience 3Xeno Diagnostics Receives 3rd Award for Laboratory Excellence 2CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 2CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 3CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 4CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 5
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: