Navigation Links
Oyster genome uncover the stress adaptation and complexity of shell formation
Date:9/19/2012

September 19, Shenzhen, China An international research team, led by Institute of Oceanology of Chinese Academy of Sciences and BGI, has completed the sequencing, assembly and analysis of Pacific oyster (Crassostrea gigas) genomethe first mollusk genome to be sequencedthat will help to fill a void in our understanding of the species-rich but poorly explored mollusc family. The study, published online today in Nature, reveals the unique adaptations of oysters to highly stressful environment and the complexity mechanism of shell formation.

"The accomplishment is a major breakthrough in the international Conchological research, with great advancement in the fields of Conchology and Marine Biology." said, Professor Fusui Zhang, Academician of Chinese Academy of Sciences, and a well-known Chinese Scientist of Conchology, "The study will provide valuable resources for studying the biology and genetic improvement of molluscs and other marine species. "

Oysters are a soft-bodied invertebrate with a double-hinged shell, which make up an essential part of many aquatic ecosystems. They have a global distribution and for many years they have much higher annual production than any other freshwater or marine organisms. In addition to its economic and ecological importance, the unique biological characteristics of oyster make it an important model for studying marine adaptations, inducing a great deal of biological and genomics research. The completed sequencing of oyster genome will provide a new horizon into understanding its natural mechanisms such as the adaptations to environmental stresses and shell formation, better exploration of marine gene resource, , among others.

Unlike many mammals and social insects, oyster as well as many other marine invertebrates is known to be highly polymorphism, which is a challenge for de novo assembling based on current strategies. In this study, researchers sequenced and assembled the Pacific oyster g
'/>"/>

Contact: Jia Liu
liujia@genomics.cn
BGI Shenzhen
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. Ocean acidification linked to larval oyster failure
2. New report puts real numbers behind history of oyster reefs
3. Leading evolutionary scientist to discuss how genome of bacteria has evolved
4. Darwin in the genome
5. Analysis of stickleback genome sequence catches evolution in action
6. Athletic frogs have faster-changing genomes
7. PNAS: Precise molecular surgery in the plant genome
8. BGI and Aspera collaborate on high-speed data exchange to advance genome research
9. Researchers announce GenomeSpace environment to connect genomic tools
10. UC Santa Cruz builds national data center for cancer genome research
11. BGI reports the completed sequence of foxtail millet genome
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/18/2013)... Kingdom, the Energy Department,s National Renewable Energy Laboratory ... published a paper describing a novel cellulose-degrading enzyme ... , commonly known as the gribble. , ... relatively unique ability to produce their own enzymes ... the biomass they eat. New biomass-degrading enzymes from ...
(Date:6/18/2013)... not a hacker lab. At Brandeis University, sophisticated ... are helping scientists understand the complex interplay between ... the virus, outer "shell" critical for replication. ... what we are finding will help researchers alter ... post-doctoral fellow Jason Perlmutter, first author of the ...
(Date:6/18/2013)... Torrent, Ph.D., Medical Research Council, Laboratory of Molecular ... a 2013 ICAAC Young Investigator Award. Torrent is ... developing the first algorithm to predict antimicrobial regions ... said, "we are now applying this algorithm to ... antimicrobial peptide leads with very appealing results." ...
Breaking Biology News(10 mins):Novel enzyme from tiny gribble could prove a boon for biofuels research 2Computer modeling technique goes viral at Brandeis 2The American Society for Microbiology honors Marc Torrent 2
... could help ships sailing smoothly. The growth of marine ... major cause of increased energy costs in the naval ... this so called 'bio-fouling'. , Ralph Liedert from the ... work on the application of artificial shark skin in ...
... that provides a vital passage through a bacterium's outer ... is built of the 'wrong' material, scientists at The ... a finding that has long-term implications for understanding diseases ... disease, and mad cow disease. , The paper in ...
... of different items by scanning the tiny barcode printed ... could make it just as easy to identify genes, ... tagging them with color-coded probes made out of synthetic ... Luo, Cornell assistant professor of biological engineering, has created ...
Cached Biology News:Beyond genes: Lipid helps cell wall protein fold into proper shape 2Beyond genes: Lipid helps cell wall protein fold into proper shape 3Tagging pathogens with synthetic DNA 'barcodes' 2Tagging pathogens with synthetic DNA 'barcodes' 3
(Date:6/18/2013)... WILMINGTON, Delaware , June 18, 2013 /PRNewswire/ ... to announce the release of the HELM biomolecular ... permissive open source MIT licence. HELM ... of a wide range of biomolecules (e.g. proteins, ... render existing small-molecule and sequence-based informatics methodologies impractical ...
(Date:6/18/2013)... -- The "Bioinformatics Market By Sector (Molecular Medicine, Agriculture, ... Data Analysis Services) & Application (Genomics, Proteomics & Drug Design) - Global ... Restraints, and Opportunities in North America , ... and Rest of World. Browse , ... Figures 364 Pages and an in-depth ...
(Date:6/18/2013)... , June 18, 2013 ... ) has announced the addition of the ... and Companies " to their offering. ... report briefly reviews basics of human genome ... applications. Current large and small sequencers are ...
(Date:6/18/2013)... DUBLIN , June 18, 2013 ... Markets ( http://www.researchandmarkets.com/research/cmbgcv/north_american ) has announced ... American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes ... Radiation Therapy (I131, Y-90)], [Applications (Cancer/Oncology, ... to 2017" report to their ...
Breaking Biology Technology:The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools 2Bioinformatics Market Worth $7.5 Billion by 2017 2Bioinformatics Market Worth $7.5 Billion by 2017 3DNA Sequencing: Technologies, Markets and Companies - 2013 Report 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 3
... that allow nanoparticles to assemble themselves into designer materials ... of Iowa State University and the Ames Laboratory reports ... Science . Travesset, an associate professor of physics ... of Energy,s Ames Laboratory, writes in the journal,s Perspectives ...
... today announced that Jeff Liter has been appointed as ... "Jeff,s diverse background in all aspects of corporate development ... Said Matt McManus, President and CEO, PrimeraDx.  "PrimeraDx,s strategy ... Plex system in the MDx market and define ...
... from the Faculty of Biology and Biotechnology at the ... of Biological Chemistry explaining why enzymes used for ... In collaboration with researchers from Berlin, they used spectroscopic ... that lead to the inactivation of the enzyme,s iron ...
Cached Biology Technology:Iowa State, Ames Lab physicist says nanoparticle assembly is like building with LEGOs 2PrimeraDx Appoints Jeff Liter as VP of Corporate Development 2If oxygen becomes the undoing of proteins 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: