Navigation Links
OncoPlex Diagnostics Announces the Addition of the Androgen Receptor Protein to Their Quantitative Breast Cancer Proteomic Panel
Date:8/8/2014

ROCKVILLE, Md., Aug. 8, 2014 /PRNewswire/ -- OncoPlex Diagnostics has developed a quantitative androgen receptor (AR) assay to add to their Breast Cancer Proteomic Panel.  The OncoPlex Diagnostics Breast Panel simultaneously measures multiple clinically-relevant tumor proteins using mass spectrometry to better inform the oncologist on therapy selection. The Breast Cancer Proteomic Panel with the inclusion of AR was featured in a presentation at the 13th Annual International Future of Breast Cancer Meeting in Huntington Beach, CA on July 19 by Dr. April Speed, Breast Surgical Oncologist, Atlanta, GA. Dr. Speed highlighted AR as a biomarker included in the multi-protein quantitation panel with EGFR, HER2, HER3, IGF1R, MET, PD-L1, and ROS1. In addition, chemotherapy guidance markers FR-alpha, hENT1, RRM1, SPARC, TOPO1, and TOPO2A are included from just two tissue sections. 

Approximately 75% of all breast cancer patients express AR, including 10-20% of all triple negative breast cancer (TNBC) patients.  Historically, women with TNBC have had limited options for treatment based on guideline-driven algorithms. AR positive TNBC patients represent a unique breast cancer subtype where new treatment options may be available.  Androgen receptor inhibitors that are FDA approved for prostate cancer are currently in clinical trials for breast cancer.  "Recent data are emerging to support androgen receptor as a drug target in breast cancer today," stated Dr. Speed, referring to data from Dr. Joyce O'Shaughnessy's group presented at the 2013 San Antonio Breast Cancer Symposium.

OncoPlex Diagnostics Protein Panels
OncoPlex Diagnostics targeted therapy panels provide actionable results for specific solid tumor indications from only two formalin-fixed, paraffin-embedded (FF
'/>"/>

SOURCE OncoPlex Diagnostics
Copyright©2014 PR Newswire.
All rights reserved

Page: 1 2

Related biology news :

1. 2012 Forecast for US Molecular Diagnostics Market Now Available From Global Information Inc.
2. Portable diagnostics designed to be shaken, not stirred
3. Ultrasensitive biosensor promising for medical diagnostics
4. Creating a future of personalized medicine: U-M forms joint venture for DNA diagnostics
5. New Market Forecasts Available for Critical Global Biotechnology Testing and Screening Markets: Molecular Diagnostics, Hematology, Clinical Chemistry and Nucleic Acid Testing
6. NIH-funded genetic sequencing tool speeds drug discovery, disease diagnostics
7. Shared Medical Resources, LLC files suit against Histologics, LLC, Womens Health Laboratories and Avero Diagnostics for Willful Patent Infringement
8. Modern Mobility Aids, Inc. Announces a Revised Agreement for the Acquisition of Lumigene
9. ChromaDex® Announces Financial Results for the Year Ended 2011
10. Improved Authentication and Confidentiality Protection. ICAP Patent Brokerage Announces for Auction Important Patents in Data Encryption and Document Security
11. FirstMark Announces New Hire Jay Houtman as Southeast Regional Sales Manager
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/24/2014)... its launch in December 2014, the 1U™ app ... trying to remember their usernames and passwords through replacing the ... To assist people who have struggled to remember usernames and ... and focuses on redefining identity, announced today that it is ...
(Date:12/22/2014)... DUBLIN , Dec. 22, 2014 Research and ... the addition of the "The Global Watermarking ... http://photos.prnewswire.com/prnh/20130307/600769 ... global digital media watermarking and fingerprinting markets. Watermarking ...
(Date:12/19/2014)... , Dec. 18, 2014 Research and Markets ... "iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & ... http://photos.prnewswire.com/prnh/20130307/600769 ... introduced the fingerprint reading feature with the iPhone 5S. ...
Breaking Biology News(10 mins):1U Offers Best Solution to the Username / Password Dilemma: For FREE! 21U Offers Best Solution to the Username / Password Dilemma: For FREE! 3The Global Watermarking and Fingerprinting Markets 2iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & Sapphire - Technology Report 2
... in a group of heat-loving bacteria by researchers at ... light a fire under next-generation biofuel production. Scientists ... to break down complex plant material such as switchgrass ... make biofuels. Conventional processes involve the addition of commercially ...
... faded since the end of the Cold War, existing ... devastating global impacts. Researchers at the University of ... effects of a hypothetical nuclear war between India and ... in distant countries. The work, by Mutlu Ozdogan ...
... in our bodies. This process is driven by microtubule filaments ... so-called motor proteins in the cytosol can control their dynamics. ... of cell division. It is composed in large part of ... size, shape and mobility of a cell. In a new ...
Cached Biology News:BESC researchers tap into genetic reservoir of heat-loving bacteria 2War-related climate change would reduce substantially reduce crop yields 2
(Date:1/22/2015)... 2015 Protocol Networks brings independent technology ... of brand-neutral, independent consultants, Protocol Networks has recently announced ... over the years, his company has attracted several clients ... Plainfield, as well as others. With the success of ...
(Date:1/22/2015)... Pipette.com has added the Eppendorf ... portfolio of Eppendorf products. , The Eppendorf Centrifuge 5424/5424 ... 5424/5424 R and receive the following:, , ... or Eppendorf Reference 2 ,     3 Free ...
(Date:1/22/2015)... Madison, WI (PRWEB) January 22, 2015 Dr. ... at the 12th annual Scripps Natural Supplements Pre-Conference seminar on ... Supplements Conference is an annual continuing education conference for health ... 15th and included the topic of probiotics in health. Dr. ...
(Date:1/22/2015)... January 22, 2015 Selexis SA, a ... Research Cell Banks (RCBs) used for drug discovery to ... Banks will include Next-Generation Sequencing (NGS) data ... de-risks biologic manufacturing by ensuring the integrity of the ...
Breaking Biology Technology:Protocol Networks Brings Independent Technology Consulting to the Constitution State 2Eppendorf Announces Promotional Bundle Which Includes: Eppendorf Centrifuge 5424, 3-Pack of Pipettes, and Tips - Available Now at Pipette.com 2Selexis Generated Research Cell Banks Now Fully Sequenced Using Next-Generation Sequencing 2
... AUSTIN, Texas and TORONTO, Oct. 3 Two ... to integrate vibration,therapy into the stem cell harvesting ... company based in Austin,Texas, has signed an exclusive ... of Toronto, Ontario. The partnership,between the two companies ...
... ),AMDL, Inc. (Amex: ADL ), a leading vertically ... US, today announced that the,Company will present at the ... Tuesday, October 7, 2008 at 10:30 a.m. ET. AMDL,s ... Hotel in the Morosco Room., The Maxim Group ...
... Stock Exchange Symbol: MS, EDMONTON, Oct. 3 ... developer in the treatment of multiple sclerosis (MS), ... (DSMB) for the,Company,s U.S. pivotal phase III MAESTRO-03 ... MS has completed a safety analysis,and recommended that ...
Cached Biology Technology:New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 2New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 3AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 2AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 3BioMS Medical's phase III U.S. multiple sclerosis trial receives positive safety review from Data Safety Monitoring Board 2
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Biology Products: