Navigation Links
On the scientific frontier
Date:6/13/2013

to be found anywhere in the world," said Wiesel. "They will undoubtedly further advance our scientific understanding and knowledge in biology and medicine."

As of 2008, 20 percent of foreign citizens who earned doctorates in the science, engineering, or health fields in the United States reported returning to their country of origin to work or live, according to the National Science Foundation. By contrast, more than 70 percent of the Pew fellows return to their home countries to set up their own laboratories. In addition to the $30,000-a-year stipend that fellows receive while training in the United States, the program also offers $35,000 to those who go back.

To date, Pew has dedicated more than $18 million in direct support for more than 200 Latin American fellows.

The 2013 Pew Latin American Fellows in the Biomedical Sciences and the laboratories in which they will train are:

Argentina

Estefana Bello, Ph.D.
Laboratory of Eric Kandel, M.D.
Columbia University
Neuroscience

Diego Fernandez, Ph.D.
Laboratory of Samer Hattar, Ph.D.
Johns Hopkins University
Neuroscience

Diana Posadas, Ph.D.
Laboratory of Richard Carthew, Ph.D.
Northwestern University
Developmental and RNA biology

Sabrina Sanchez, Ph.D.
Laboratory of Steve Kay, Ph.D.
University of Southern California
Genetic regulation and circadian rhythm

Brazil

Paulo Jos Teixeira, Ph.D.
Laboratory of Jeff Dangl, Ph.D.
University of North Carolina at Chapel Hill
Plant biology and pathogenesis

Chile

Carlos Blondel, Ph.D.
Laboratory of Matthew Waldor, M.D., Ph.D.
Brigham and Women's Hospital
Cell biology and pathogenesis

Marco Contreras, Ph.D.
Laboratory of Jean-Marc Fellous, Ph.D.
University of Arizona
Neurobiology and behavior

Andres Herrada, Ph.D.
Laboratory of Dario Vignali, Ph.D.
St. Ju
'/>"/>

Contact: Chelsea Toledo
ctoledo@pewtrusts.org
202-540-6846
Pew Health Group
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. Emotient and iMotions Partner to Offer Unique Integrated Facial Expression Recognition, Bio Sensor and Eye Tracking Solution for Usability, Gaming, Market and Academic/ Scientific Research
2. PNNL staff recognized for scientific accomplishments, moving technologies into the marketplace
3. Renaissance in new drugs for rare diseases: Report in worlds largest scientific socity magazine
4. Cell biologists say immigration reform critical to scientific education and competitiveness
5. New scientific studies reveal Midwestern frogs decline, mammal populations altered by invasive plant
6. Society of Interventional Radiology: 38th Annual Scientific Meeting
7. Ludwig advancements in immunotherapy and epigenetics top scientific program at AACR
8. Mercyhurst Universitys new DNA sequencer to accelerate scientific research in region
9. NRC Research Press adds a new title to collection of scientific and technical journals
10. Wake Forest Innovations Launches New Dot-Com Companies Offering Industry and Business Easy Access to Broad Range of Scientific Services
11. Wiley makes scientific PDFs interactive with the ReadCube Web Reader from Labtiva
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:4/17/2014)... NJ. April 16, 2014. Kessler Foundation has been ... million from the Department of Defense Spinal Cord ... principal investigator for the randomized, double-blinded, controlled, multi-site ... bone and muscle strength after spinal cord injury. ... & Engineering Research at Kessler Foundation. Two additional ...
(Date:4/17/2014)... births, Down syndrome - or trisomy 21 - is ... results from a chromosomal abnormality where cells of affected ... of the human genome). A study conducted by Stylianos ... Medicine and Development at the University of Geneva (UNIGE) ... light on how the extra chromosome 21 upsets the ...
(Date:4/17/2014)... ago, Katia Silvera , a postdoctoral scholar at the ... field trip in a mountainous area in central Panama when ... , Unable to identify it, they contacted German Carnevali, a ... be an unnamed species. So Carnevali recently named it after ... genus name, comprising about 40 species in the world. ...
Breaking Biology News(10 mins):Kessler Foundation awarded Department of Defense grant for spinal cord injury research 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 3Orchid named after UC Riverside researcher 2Orchid named after UC Riverside researcher 3
... 2013) The Algae Biomass Organization (ABO), the trade ... of "Industrial Algae Measurements, Version 6.0" (IAM 6.0), ... by the organization for measuring and comparing algae ... new technologies to create fuels, feeds, nutritional supplements, ...
... this Moderate Resolution Imaging Spectroradiometer (MODIS) satellite image collected on ... Terra satellite and actively burning areas, detected by MODIS,s thermal ... is banned in Indonesia, but that does not always stop ... unusual dry spell in the area (this is usually the ...
... influence actual heart health, according to new research. A study ... ways in which your spouse is supportive and how ... on your overall cardiovascular health. The findings reveal that ... other as ambivalent that is, sometimes helpful and sometimes ...
Cached Biology News:ABO updates standards for measuring algae industry operations 2ABO updates standards for measuring algae industry operations 3ABO updates standards for measuring algae industry operations 4Heart disease risk linked with spouses' social support 2
(Date:1/15/2014)... DTS Language Services, Inc . is ... for Life Science organizations who need document translations. Clients ... of their documents in advance with a selection of nearly ... translations, often a critical factor in clinical and scientific fields, ...
(Date:1/14/2014)... Doylestown, PA (PRWEB) January 14, 2014 Date: ... p.m. , Location: Warrington Country Club, 1360 Almshouse Road, Warrington, ... only national nonprofit organization solely dedicated to finding a cure ... those affected worldwide, will host its annual Crystal Ball on ...
(Date:1/14/2014)... (PRWEB) January 14, 2014 EquitiesIQ, a ... Inc. (OTCQB: ALQA). Alliqua is an emerging biomedical company ... the wound care market. , Free report download: ... with a seasoned management team and Board, which launched ...
(Date:1/14/2014)... Jan. 14, 2014  RXi Pharmaceuticals Corporation (OTCQX: RXII), ... commercializing innovative therapies addressing major unmet medical needs ... the Notice of Allowance from the United States ... RNAi compounds (sd-rxRNA®), for the treatment of fibrosis. ...
Breaking Biology Technology:DTS Improves Efficiency for Life Science Document Translations 2Hepatitis B Foundation to Host Annual Crystal Ball Gala 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 2RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 3
... CARY, N.C., May 19, 2011 ... its flexible 100% web-based Life Science Study Management ... successfully used globally by Leading European and USA ... eStudy,s on-line study design, management, communication, data collection ...
... CLARA, Calif., May 19, 2011 The 2012 federal ... National Nanotechnology Initiative (NNI), a federal interagency research and ... manipulation of matter at the nanoscale—a measurement of particles ... meter) in size.  While nanoscale materials are found in ...
... Inc., a Massachusetts-based biopharmaceutical company, announced today that it ... Administration on a Special Protocol Assessment (SPA) for a ... agent for patients with newly diagnosed prostate cancer. The ... with definitive results expected by 2015. The randomized study ...
Cached Biology Technology:Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 2Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 3Environmental Training Center Prepares Companies to Handle Nanotechnology Environmental and Human Safety Impacts 2Advantagene Announces SPA Agreement With FDA to Launch Phase 3 Trial for Novel Vaccine Aimed at Preventing Prostate Cancer Recurrence 2
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products: