Navigation Links
Ocean conditions likely to reduce Colorado River flows during this winter's drought
Date:10/1/2010

n linked to past occurrence of major droughts in the Midwest and the Southwest, including the Dust Bowl of the 1930s.

"It's three different things working on different times scales," MacDonald said. "You may not get them to line up that frequently."

Tingstad and MacDonald found a "striking and significant propensity" for droughts in northeastern Utah when cool sea-surface temperatures in the Pacific associated with La Nia and the negative phase of the PDO were coupled with warm temperatures in the North Atlantic linked to the positive phase of the AMO. During such episodes, snowpack declined on average between 9 percent and 10 percent, and river discharge decreased on average by 18 percent.

The three conditions last converged at least five times between 1945 and 1965, a period that was characterized by generally depressed but variable flows in the river, they said.

The findings are troublesome because not only are all three conditions predicted for 2010󈝷, but they are expected to be particularly strong, the researchers say. The coming year's La Nia and AMO are at this point supposed to be the strongest in 10 years, and a strong negative PDO is also building.

The convergence increases the likelihood that Lake Mead, already diminished by 11 years of drought, will fall below 1,075 feet above sea level a threshold that can result in the reduction of water allocations in Nevada and Arizona, the researchers say. Under a series of agreements among seven U.S. states along the Colorado River and Mexico, California has first rights to the water, so it would not face the same restrictions. Water levels at Lake Mead currently stand just nine feet from the critical threshold, at 1,084 feet above sea level.

"We're looking at a situation that could pit us against our neighbors," said MacDonald, who is also a UCLA professor of geography. "We've never had to face such a severe decline in Lake Mead and
'/>"/>

Contact: Meg Sullivan
msullivan@support.ucla.edu
310-825-1046
University of California -- Los Angeles
Source:Eurekalert

Page: 1 2 3 4

Related biology news :

1. Why fish dont freeze in the Arctic Ocean
2. New Naked Scientists series investigates our oceans
3. Ancient microbes responsible for breathing life into ocean deserts
4. Scripps Oceanography biologists awarded prestigious honors
5. Oceans color affects hurricane paths
6. NOAA, IOOS partners deploy new ocean observational equipment near San Juan
7. Coastal creatures may have reduced ability to fight off infections in acidified oceans
8. Study finds deep, open ocean is vastly under-explored
9. Ice-free ocean may not absorb CO2, a component in global warming
10. Findings overturn old theory of phytoplankton growth, raise concerns for ocean productivity
11. Study suggests more fish than thought may thrive in the oceans depths
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/23/2014)... Fruit and vegetable consumption could be as good for ... , The research, conducted by the University of Warwick,s ... England, and published by BMJ Open focused ... mental wellbeing were consistently associated with an individual,s fruit ... mental wellbeing ate five or more portions of fruit ...
(Date:9/23/2014)... infant chimpanzees from their mothers are well documented, little ... of early life experience. In a year-long study, scientists ... that those who were removed from their mothers early ... performers are likely to show behavioral and social deficiencies ... in the open-access journal PeerJ , was led ...
(Date:9/22/2014)... GAINESVILLE, Fla. --- Many native species have vanished ... University of Florida scientists have discovered how fossils ... , The key lies in organic materials found ... ancient ecosystems functioned, according to a new study ... the Journal of Herpetology . Pre-human island ...
Breaking Biology News(10 mins):Eating five a day may keep the blues away 2Chimpanzees raised as pets or performers suffer long-term effects on their behavior 2Answer to restoring lost island biodiversity found in fossils 2
... New findings from a landmark clinical trial show that although ... to develop age-related macular degeneration (AMD), a potentially blinding eye ... do not predict how patients will respond to Lucentis and ... "wet" form of AMD. This new data from the Comparison ...
... change to current dosages for sleeping medications in women ... that flu dosages for women be reconsidered as well. ... common practice, but we aren,t there yet. To accelerate ... education and clinical training, the Sex and Gender Women,s ...
... from engineers at Rensselaer Polytechnic Institute and the University of ... powerful new tool for manipulating cells. Results of the study, ... blue light can be used as a switch to prompt ... process of clustering, or oligomerization, is commonly employed by nature ...
Cached Biology News:Major clinical trial finds no link between genetic risk factors and 2 top wet AMD treatments 2Sex and gender competency essential to medical care 2Nature Methods study: Using light to control cell clustering 2
(Date:9/23/2014)... 23, 2014 Texas Fertility Center (TFC) ... South Austin, expanding a Central Texas footprint that includes ... The satellite office for the region’s most established practice ... the South Austin, Buda, Kyle and San Marcos communities. ... fertility treatment directly to individuals and couples living in ...
(Date:9/23/2014)... (PRWEB) September 23, 2014 The ... a developer of cellular modems , platforms ... in the Startup category for the 2014 Tekne ... held at the Minneapolis Convention Center on Thursday, ... and individuals who have shown superior technology innovation ...
(Date:9/22/2014)... YORK and SANTA CLARA, Calif. ... Corp. (NASDAQ: WBMD ), the leading source ... new WebMD/Medscape survey that provide novel insights ... in aiding diagnosis and care.  Dr. Eric Topol ... and digital medicine, who serves as both Editor-in-Chief of ...
(Date:9/22/2014)... in a mouse model of pancreatic cancer identified distinct ... including significant differences from the primary tumor that may ... their study reported in the Sept. 25 issue of ... Hospital (MGH) Cancer Center identified several different classes of ... to be targets for improved treatment of the deadly ...
Breaking Biology Technology:Opening Doors to a Family: Texas Fertility Center Announces Newest Fertility Clinic in South Austin 2Opening Doors to a Family: Texas Fertility Center Announces Newest Fertility Clinic in South Austin 3NimbeLink Named Finalist for 15th Annual Tekne Awards 2NimbeLink Named Finalist for 15th Annual Tekne Awards 3WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 2WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 3WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 4Massachusetts General study reveals gene expression patterns in pancreatic CTCs 2Massachusetts General study reveals gene expression patterns in pancreatic CTCs 3
... /PRNewswire-Asia-FirstCall/ -- Genesis,Pharmaceuticals Enterprises, Inc. (OTC Bulletin ... pharmaceutical company with its principal operations in ... it engaged KPMG Huazhen,("KPMG"), a member firm ... firms,affiliated with KPMG International, to assist the ...
... & Company, LLC, a,Boston-based life science investment bank, ... joined the firm as senior advisor. In ... on internal and client-related activities including,merger & acquisition ... focus on biopharmaceutical transactions. "We are delighted ...
... PTNEW YORK, Jan. 13 Keryx Biopharmaceuticals, Inc. (Nasdaq: ... Weiss, the Company,s Chairman and Chief Executive Officer, is ... Healthcare Conference being held in San Francisco.Mr. Weiss, presentation ... 1:00pm PT and will be accessible from the Investor ...
Cached Biology Technology:Genesis Pharmaceuticals Appoints KPMG to Help Develop a SOX 404 Compliance Program 2Genesis Pharmaceuticals Appoints KPMG to Help Develop a SOX 404 Compliance Program 3Keryx Biopharmaceuticals to Present at the J.P. Morgan 27th Annual Healthcare Conference 2
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: