Navigation Links
Oberthur Technologies XPon Offer
Date:4/23/2008

PARIS, April 23 /PRNewswire-FirstCall/ -- This press release is not and must not be, directly or indirectly, distributed or made public in Australia, Canada, Japan, South Africa or the United States of America. The Offer is not being made to persons in those jurisdictions or elsewhere where their participation requires further offer documents, filings or other measures in addition to those required by Swedish law. This is a translation of the original Swedish language press release. In the event of a dispute, the original Swedish language press release shall prevail.

98.7% of the Shares in XPonCard Group AB (publ) Tendered in the Offer or Acquired in the Market

On 19 February 2008, Oberthur Technologies S.A. ("Oberthur") announced a recommended cash offer (the "Offer") to acquire all shares in XPonCard Group AB (publ) ("XPonCard"). On 8 April 2008, Oberthur declared the Offer unconditional and extended the acceptance period until 18 April 2008.

A total of 38,239 shares, representing 0.9% of the shares and votes in XPonCard, have been tendered during the extension of the acceptance period. Consequently, a total of 3,889,604 shares in XPonCard, representing 86.7% of the shares and votes in XPonCard, have been tendered in the Offer. Up until and including 22 April 2008, Oberthur has also acquired in total 539,250 shares in the market, representing 12.0% of the shares and votes in XPonCard. Accordingly, following the expiration of the extended acceptance period and including the shares acquired in the market, Oberthur will own in aggregate 4,428,854 shares in XPonCard, representing 98.7% of the shares and votes in XPonCard.

Settlement in respect of shares tendered during the extension of the acceptance period is expected to commence on or about 30 April 2008. The Offer will not be extended further. However, Oberthur may acquire additional shares in XPonCard in the market.

As previously announced, Oberthur will initiate mandatory
'/>"/>

SOURCE Oberthur Technologies
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2

Related biology news :

1. Beijing Genomics Institute adds AB SOLiD system to its next generation sequencing technologies
2. Europe develops new technologies to boost health of livestock
3. The bombardier beetle, power venom and spray technologies
4. Atmel and Phoenix Technologies Collaborate to Create Next-generation Security Solutions for PCs
5. Phoenix Technologies and Atmel Collaborate to Create Next-Generation Security Solutions for PCs
6. e-SMART Technologies Continues Delivery of Its New Super SMART Card in South Korea
7. e-Smart(R) Technologies Delivers Its New Super Smart Card(TM) in South Korea.
8. Material Technologies Holds First Electrochemical Fatigue Sensor Training for Private Inspection Firms
9. e-Smart(R) Technologies, Inc., Announces Next Generation Superthin Polyimide Flexible Circuit Biometric Super Smart Card(TM) card, the i am(TM) Card.
10. e-Smart Technologies, Inc. Responds to Information Subpoenas From Securities & Exchange Commission
11. e-Smart Technologies Responds to Press Release Issued By IDsmart LLC
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/19/2013)... Course at the Marine Biological Laboratory (MBL), Woods ... Microbiology site by the American Society for Microbiology ... recognizes institutions and the scientists who worked there ... science of microbiology. A ceremony unveiling the ... for Saturday, June 22, 2013, at 4:30 pm ...
(Date:6/19/2013)... University of Pittsburgh has developed antibacterial compounds, derived ... be potential treatments for drug-resistant bacterial infections and ... are quite small, making them inexpensive and easy ... June 2013 issue of the journal Antimicrobial ... many probable applications will likely be the chronic ...
(Date:6/19/2013)... June 19, 2013 A decade-long JDRF-funded study ... Helmholtz Zentrum Mnchen, Germany, is providing a deeper ... risk of developing type 1 diabetes (T1D), highlighting ... for the disease. The study, "Seroconversion to Multiple ... in Children," was published today in The ...
Breaking Biology News(10 mins):Microbial diversity course designated as a 'Milestones in Microbiology' site 2HIV-derived antibacterial shows promise against drug-resistant bacteria 2New data on islet autoantibodies in young children defines early type 1 diabetes development 2
... A newly discovered mechanism by which an infectious fungus ... virulence, according to Howard Hughes Medical Institute investigators at ... in light following fungal invasion of the human body ... sparks infection, the researchers said. , The discovery in ...
... irreversible damage to the heart that can cause ... the limited ability of the myocardium to regenerate ... University now document the existence of a previously ... with therapeutic potency for myocardial tissue regeneration following ...
... (WHO) warned about increased risk of vector-borne diseases ... areas in Southeast Asia. Nearly four weeks after ... the organization is strengthening its disease surveillance, stagnant ... multiply to sufficient levels, to potentially cause severe ...
Cached Biology News:Light therapy may combat fungal infections, new evidence suggests 2Light therapy may combat fungal infections, new evidence suggests 3WHO Warns Of Increased Risk Of Vector-borne Diseases In Tsunami-affected Areas 2WHO Warns Of Increased Risk Of Vector-borne Diseases In Tsunami-affected Areas 3WHO Warns Of Increased Risk Of Vector-borne Diseases In Tsunami-affected Areas 4
(Date:6/18/2013)... June 18, 2013 The human skin is ... as an important human body part. Similar to the liver, ... order to function, repair and grow. Recent reports from the ... supplements, is just as important as other life supporting organs. ... aid in skin cell reproduction, increase the appearance of skin, ...
(Date:6/18/2013)... , June 18, 2013 ... using the company,s  proprietary AMCA Guided Bone Regeneration (GBR) Dental ... implants. A common problem encountered when patients have ... of sufficient bone volume to house the implant. Consequently there ... bone substitute until the natural bone regenerates. The bone substitute ...
(Date:6/18/2013)... June 18, 2013 ... research firm, announces the initiation of full ... biopharmaceutical company developing and marketing products for ...      (Logo: http://photos.prnewswire.com/prnh/20130417/608168) ... examining the investment merits of BioAlliance Pharma, ...
(Date:6/18/2013)... , June 18, 2013 Mapi ... (APIs), generic and innovative intermediates, and finished dosage forms based ... has been granted a United States ... Europe for the oral treatment of ... is titled Intermediate Compounds and Processes for the Preparation ...
Breaking Biology Technology:Natural Acne Remedies Through Diet, Probiotic Action Shares New Insight on What Foods May Help Lead to Clear Skin 2RegeneCure Starts Clinical Study Using Polymeric Bone Stimulating Membrane for Dental Implants 2RegeneCure Starts Clinical Study Using Polymeric Bone Stimulating Membrane for Dental Implants 3Edison Expands French Healthcare Sector Coverage With Initiation of Coverage on BioAlliance Pharma 2Edison Expands French Healthcare Sector Coverage With Initiation of Coverage on BioAlliance Pharma 3Mapi Pharma Granted United States Patent for Pain Relief Medication "Tapentadol" 2
... . -- Fiserv, Inc. said its Interactive Technologies ... A. Weber chief operating officer. In her new ... the Interactive Technologies Advantage Fee System software and ... clients. , ,Weber joins Interactive Technologies from ...
... biotechnology sector, she began to notice a certain pattern: Scientists ... the business world to be a much different place than ... , ,"Along the way, I realized that it was that ... a product just as effectively as a competitor," Villars said. ...
... J.J. Keller & Associates is launching Prospera ... tested on more than 13,000 human resources professionals, the ... built around five areas of concern for human resources ... on how those areas affect a company's bottom line; ...
Cached Biology Technology:Can tech people be business leaders? Upcoming seminar may have the answer 2Can tech people be business leaders? Upcoming seminar may have the answer 3J.J. Keller, Modine Manufacturing, Gustave A. Larson Co., Esker, Firstlogic, Software One 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: