Navigation Links
No plain sailing for marine life as climate warms
Date:11/29/2011

Direct effects of climate warming on biodiversity pose a serious conservation challenge for marine life, according to new research published in Science. Marine life may need to relocate faster than land species as well as speed up alterations in the timing of major life cycle events. This challenges previous thinking that marine life in the ocean would respond more gradually than species on land because of slower warming in the oceans.

"Analyses of global temperature found that the rate at which marine life needs to relocate is as fast, or in some places faster, than for land species. This is despite ocean warming being three times slower than land" says paper co-author, Dr Elvira Poloczanska from CSIRO's Climate Adaptation Flagship.

Dr Poloczanska said that globally, an increasing number of species are responding to climate change by changing their distributions and the timing of life cycle events such as breeding, spawning and migrations.

She said that a one degree change in ocean temperature may mean that marine plants and animals will have to travel hundreds of kilometres to stay in their comfort zones. This can present major problems for marine organisms, particularly those that are unable to move long distances such as corals.

This collaborative work was led by Dr Mike Burrows from the Scottish Association of Marine Science, UK, and Dr David Schoeman of the University of Ulster, UK, and is a product from the Marine Impacts Working Group at the National Centre for Ecological Analysis and Synthesis, California. Dr Poloczanska and Associate Professor Anthony J. Richardson from the CSIRO Climate Adaptation Flagship and the University of Queensland lead the working group.

Writing in Science, the team considered two indicators to measure the pace of change in temperatures over the past 50 years: the shift in temperature across the landscape and seascape, and; the shift in temperature seasonality with warming
'/>"/>

Contact: Anne Leitch
Anne.Leitch@csiro.au
61-738-335-652
CSIRO Australia
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. Great bustards to be released on Salisbury Plain
2. Bodys anti-HIV drug explained
3. Duke team explains a longtime visual puzzler in new way
4. Diatom genome helps explain success in trapping excess carbon in oceans
5. Newly-discovered mechanism can explain the Beckwith-Wiedemann syndrome
6. Study may explain exercise-induced fatigue in muscular dystrophies
7. How do bacteria swim? Brown physicists explain
8. New research helps explain genetics of Parkinsons disease
9. MIT researchers explain mystery of gravity fingers
10. Shared survival mechanism explains why good nerve cells last and bad cancer cells flourish
11. Study helps explain connection between sleep apnea, stroke and death
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/11/2014)... Minn. , Dec. 10, 2014  Data ... physiologic monitoring, has released a new series of ... of preclinical toxicology researchers. M series, part of ... toxicologists collect the best possible physiologic data when ... Adding functional endpoints to toxicology studies has ...
(Date:12/10/2014)... , Dec. 08, 2014 Research and Markets ... addition of the "Biometrics Market in Japan ... http://photos.prnewswire.com/prnh/20130307/600769 The ... such as rural banking and upgradation of the ... witnessed in the market. Besides the aforementioned projects, ...
(Date:12/3/2014)... , Dec. 2, 2014   Marvin ... deployed, innovative test solutions for military, aerospace, and ... version of its successful TS-900 PXI semiconductor ... and features of high-end systems to customers at ... value compared to traditional ATE. ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Biometrics Market in Japan 2014-2018: Key Vendors are DDS, Fujitsu, Hitachi and NEC 2Marvin Test Solutions Brings New Capabilities to PXI-Based Semiconductor Test with TS-960 2Marvin Test Solutions Brings New Capabilities to PXI-Based Semiconductor Test with TS-960 3
... proteins of human cells infected with a common cold virus ... the genetic information we hold on animals by around 70 ... Methods , could revolutionise our understanding of animal genetics and ... SARS that jump the species barrier from animals to humans. ...
... nuclear magnetic resonance (NMR) technology is capable of detecting ... of blood. Microvesicles shed by cancer cells are even ... detecting them could prove a simple means for diagnosing ... , investigators at the Massachusetts General Hospital (MGH) Center ...
... Nobody knows the remarkable properties of human skin like ... our skin sensitive, sending the brain precise information about ... preserve a protective barrier against the world. Combining these ... exciting challenge for Stanford Chemical Engineering Professor Zhenan Bao ...
Cached Biology News:Scientists discover new method of gene identification 2Detection, analysis of 'cell dust' may allow diagnosis, monitoring of brain cancer 2Detection, analysis of 'cell dust' may allow diagnosis, monitoring of brain cancer 3Touch-sensitive plastic skin heals itself 2Touch-sensitive plastic skin heals itself 3
(Date:12/22/2014)... , Dec. 22, 2014  Alternative Energy ... that it has signed a letter of intent ... has developed and patented a nanotechnology-based development platform ... products that enable rapid on-site collection and testing ... and health issues in an immediate, non-invasive and ...
(Date:12/22/2014)... 2014 The American Journal ... original research, reviews and editorials addressing developments and ... today published a provocative article exploring the role ... and potential treatment of prostate cancer. , ... proposes the possibility that there could be a ...
(Date:12/19/2014)... PA (PRWEB) December 19, 2014 ... leading developer and manufacturer of needle-free injection technology, ... agreement with Immunomic Therapeutics, Inc. (“ITI”) for ITI ... device with its LAMP™ vaccine platform. , ... an exclusive Worldwide license to the Biojector®-2000 that ...
(Date:12/19/2014)... 2014 Naurex Inc., a biopharmaceutical company leveraging ... of the central nervous system, today announced that ... will present at the 33 rd annual J.P. ... at 3:00 p.m. PST on Tuesday, January 13, 2015, ... Francisco, Calif. About Naurex ...
Breaking Biology Technology:ALNE Announces Intention To Acquire BioTechPharma 2Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 2Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 3Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 4Bioject and Immunomic Therapeutics Enter into an Agreement for License of Needle-Free Technology for LAMP-vax Vaccines 2Bioject and Immunomic Therapeutics Enter into an Agreement for License of Needle-Free Technology for LAMP-vax Vaccines 3Naurex to Present at 33rd Annual J.P. Morgan Healthcare Conference 2
... Serial Analysis of Gene ... differentially expressed genes by comparative analyses. SAGE is a powerful ... analysis of large numbers of cellular transcripts, leading to a ... accurate quantitative analysis of the relative levels of genes expressed ...
... Purpose , ... note in this series describes an LC/MS/MS method for the ... (TAC, aka FK-506), Sirolimus (SIR, aka Rapamycin) and Everolimus (EVE, ... simple and robust hardware configuration and shows to be fast ...
... , , ... As the study of protein biomarkers ... based on protein pathway information and discovery-based proteomics experiments. Even larger ... on microarray-based gene expression studies or other genomic information. , ...
Cached Biology Technology:Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 2Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 3Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 4Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 5A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 2A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 3A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 4A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 5Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 2Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 3Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 4Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 5
Agarose II (Low Melt)...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
Biology Products: