Navigation Links
Newly demonstrated capabilities of low-powered nanotweezers may benefit cellular-level studies
Date:9/17/2012

Using ultra-low input power densities, researchers at the University of Illinois at Urbana-Champaign have demonstrated for the first time how low-power "optical nanotweezers" can be used to trap, manipulate, and probe nanoparticles, including fragile biological samples.

"We already know that plasmonic nanoantennas enhance local fields by up to several orders of magnitude, and thus, previously showed that we can use these structures with a regular CW laser source to make very good optical tweezers," explains, Kimani Toussaint, Jr., assistant professor of mechanical science and engineering at Illinois. "This is exciting because, for the first time, we're showing that, the near-field optical forces can be enhanced even further, without doing anything extra in terms of fabrication, but rather simply by exploiting the high-peak powers associated with using a femtosecond (fs) optical source.

"We used an average power of 50 microwatts to trap, manipulate, and probe nanoparticles. This is 100x less power than what you would get from a standard laser pointer."

In their recent paper, "Femtosecond-pulsed plasmonic nanotweezers" published in the September 17 issue of Scientific Reports; doi:10.1038/srep00660), the researchers describe how a femtosecond-pulsed laser beam significantly augments the trapping strength of Au bowtie nanoantennas arrays (BNAs), and the first demonstration of use of femtosecond (fs) source for optical trapping with plasmonic nanotweezers.

"Our system operates at average power levels approximately three orders of magnitude lower than the expected optical damage threshold for biological structures, thereby making this technology very attractive for biological (lab-on-a-chip) applications such as cell manipulation," Toussaint added. "This system offers increased local diagnostic capabilities by permitting the probing of the nonlinear optical response of trapped specimens, enabling studies of in vitro fluo
'/>"/>

Contact: Kimani C. Toussaint, Jr.
ktoussai@illinois.edu
217-244-4088
University of Illinois College of Engineering
Source:Eurekalert  

Page: 1 2

Related biology news :

1. Newly released FDA draft guidelines for biosimilar drugs to be discussed at conference
2. Scripps Research discoveries lead to newly approved drug for infant respiratory distress syndrome
3. Newly discovered foot points to a new kid on the hominin block
4. Newly found protein helps cells build tissues
5. Scientists advance field of research with publication of newly validated method for analyzing flavanols in cocoa
6. Key proteins newly discovered form and function may provide novel cancer treatment target
7. Newly discovered breast milk antibodies help neutralize HIV
8. Newly discovered dinosaur implies greater prevalence of feathers
9. U of M researchers: Newly discovered genetic markers could signal colon cancer development
10. ORNLs newly licensed neutron detector will advance human disease research
11. Newly discovered letters and translated German ode expand Texas link to infamous Bone Wars
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Newly demonstrated capabilities of low-powered nanotweezers may benefit cellular-level studies
(Date:4/17/2014)... NJ. April 16, 2014. Kessler Foundation has been ... million from the Department of Defense Spinal Cord ... principal investigator for the randomized, double-blinded, controlled, multi-site ... bone and muscle strength after spinal cord injury. ... & Engineering Research at Kessler Foundation. Two additional ...
(Date:4/17/2014)... births, Down syndrome - or trisomy 21 - is ... results from a chromosomal abnormality where cells of affected ... of the human genome). A study conducted by Stylianos ... Medicine and Development at the University of Geneva (UNIGE) ... light on how the extra chromosome 21 upsets the ...
(Date:4/17/2014)... ago, Katia Silvera , a postdoctoral scholar at the ... field trip in a mountainous area in central Panama when ... , Unable to identify it, they contacted German Carnevali, a ... be an unnamed species. So Carnevali recently named it after ... genus name, comprising about 40 species in the world. ...
Breaking Biology News(10 mins):Kessler Foundation awarded Department of Defense grant for spinal cord injury research 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 3Orchid named after UC Riverside researcher 2Orchid named after UC Riverside researcher 3
... 2013) The Algae Biomass Organization (ABO), the trade ... of "Industrial Algae Measurements, Version 6.0" (IAM 6.0), ... by the organization for measuring and comparing algae ... new technologies to create fuels, feeds, nutritional supplements, ...
... this Moderate Resolution Imaging Spectroradiometer (MODIS) satellite image collected on ... Terra satellite and actively burning areas, detected by MODIS,s thermal ... is banned in Indonesia, but that does not always stop ... unusual dry spell in the area (this is usually the ...
... influence actual heart health, according to new research. A study ... ways in which your spouse is supportive and how ... on your overall cardiovascular health. The findings reveal that ... other as ambivalent that is, sometimes helpful and sometimes ...
Cached Biology News:ABO updates standards for measuring algae industry operations 2ABO updates standards for measuring algae industry operations 3ABO updates standards for measuring algae industry operations 4Heart disease risk linked with spouses' social support 2
(Date:1/15/2014)... DTS Language Services, Inc . is ... for Life Science organizations who need document translations. Clients ... of their documents in advance with a selection of nearly ... translations, often a critical factor in clinical and scientific fields, ...
(Date:1/14/2014)... Doylestown, PA (PRWEB) January 14, 2014 Date: ... p.m. , Location: Warrington Country Club, 1360 Almshouse Road, Warrington, ... only national nonprofit organization solely dedicated to finding a cure ... those affected worldwide, will host its annual Crystal Ball on ...
(Date:1/14/2014)... (PRWEB) January 14, 2014 EquitiesIQ, a ... Inc. (OTCQB: ALQA). Alliqua is an emerging biomedical company ... the wound care market. , Free report download: ... with a seasoned management team and Board, which launched ...
(Date:1/14/2014)... Jan. 14, 2014  RXi Pharmaceuticals Corporation (OTCQX: RXII), ... commercializing innovative therapies addressing major unmet medical needs ... the Notice of Allowance from the United States ... RNAi compounds (sd-rxRNA®), for the treatment of fibrosis. ...
Breaking Biology Technology:DTS Improves Efficiency for Life Science Document Translations 2Hepatitis B Foundation to Host Annual Crystal Ball Gala 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 2RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 3
... CARY, N.C., May 19, 2011 ... its flexible 100% web-based Life Science Study Management ... successfully used globally by Leading European and USA ... eStudy,s on-line study design, management, communication, data collection ...
... CLARA, Calif., May 19, 2011 The 2012 federal ... National Nanotechnology Initiative (NNI), a federal interagency research and ... manipulation of matter at the nanoscale—a measurement of particles ... meter) in size.  While nanoscale materials are found in ...
... Inc., a Massachusetts-based biopharmaceutical company, announced today that it ... Administration on a Special Protocol Assessment (SPA) for a ... agent for patients with newly diagnosed prostate cancer. The ... with definitive results expected by 2015. The randomized study ...
Cached Biology Technology:Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 2Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 3Environmental Training Center Prepares Companies to Handle Nanotechnology Environmental and Human Safety Impacts 2Advantagene Announces SPA Agreement With FDA to Launch Phase 3 Trial for Novel Vaccine Aimed at Preventing Prostate Cancer Recurrence 2
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products: