Navigation Links
New theory on why male, female lemurs same size
Date:7/14/2009

When it comes to investigating mysteries, Sherlock Holmes has nothing on Rice University biologist Amy Dunham. In a newly published paper, Dunham offers a new theory for one of primatology's long-standing mysteries: Why are male and female lemurs the same size?

In most primate species, males have evolved to be much larger than females. Size is an advantage for males that guard females to keep other males from mating with them, and evolutionary biologists have long wondered why lemurs evolved differently. Some theories have suggested that environment played a role or that lemur social development was altered due to the extinction of predatory birds.

"Scientifically, this is quite a big question that researchers have debated for over 20 years," said Dunham, assistant professor of ecology and evolutionary biology. "I actually started doing research on lemurs as an undergraduate, working in Ranomafana (National Park in Madgascar), and the question about size monomorphism has bugged me since then."

In a paper featured on the cover of this month's Journal of Evolutionary Biology, Dunham offers one of the first new theories on lemur monomorphism in more than a decade.

After an exhaustive review of the observational work done on lemurs, Dunham came to the conclusion that male lemurs do guard their mates, just like other primates. But unlike gorillas and other primates that fight for mating rights with females, male lemurs have evolved to passively guard their mates.

They do this by depositing a solid plug inside the female's reproductive tract just as they finish mating. The plug is deposited as a liquid protein but quickly hardens and stays in place for a day or two. Since many female lemurs are sexually responsive to males for only one day out of the entire year, the plug serves the purpose of preventing other males from mating with the female, while also freeing the male to mate with other females during the br
'/>"/>

Contact: David Ruth
druth@rice.edu
713-348-6327
Rice University
Source:Eurekalert  

Page: 1 2 3

Related biology news :

1. New theory gives more precise estimates of large-scale biodiversity
2. MS study offers theory for why repair of brains wiring fails
3. Rumbaughs theory links positions of Wilson, Skinner
4. Clarke clarifies pattern recognition theory
5. Researchers disprove 15-year-old theory about the nervous system
6. Rethinking the genetic theory of inheritance
7. Nearly a century later, new findings support Warburg theory of cancer
8. No place like home: New theory for how salmon, sea turtles find their birthplace
9. Scientists present moving theory behind bacterial decision-making
10. Revised theory suggests carbon dioxide levels already in danger zone
11. Armored fish study helps strengthen Darwins natural selection theory
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
New theory on why male, female lemurs same size
(Date:3/12/2015)... March 12, 2015 The mascots of the ... Hospital, part of Wake Forest Baptist Medical Center. They ... the 2015 ACC Men,s Basketball Tournament. Young patients enjoyed ... and getting their autographs. Brenner Children,s Hospital ... is the only children,s hospital in northwest ...
(Date:3/11/2015)...   The Sync Project™ today announced ... and harness music to improve health. The platform ... measurements of physiology, enabling the study of the ... populations. It is designed for medical and health ... studies and accelerate the discovery of the clinical ...
(Date:3/10/2015)...  NXT-ID, Inc. (NASDAQ: NXTD ... authentication company focused on the growing mobile commerce ... been named the "Number One Best Tech Gift ... Modern ( http://www.rethinkmodern.com/ ) is a web magazine focused ... that have a unique function or design.  ...
Breaking Biology News(10 mins):Introducing The Sync Project, a Global Collaboration Harnessing the Scientific Potential of Music for Health 2Introducing The Sync Project, a Global Collaboration Harnessing the Scientific Potential of Music for Health 3NXT-ID's Wocket Smart Wallet Named Number One Best Tech Gift for 2015 by Rethink Modern 2NXT-ID's Wocket Smart Wallet Named Number One Best Tech Gift for 2015 by Rethink Modern 3NXT-ID's Wocket Smart Wallet Named Number One Best Tech Gift for 2015 by Rethink Modern 4
... MADISON, WI, SEPTEMBER 21, 2009 A new ... , documents the history, science, and applications of tall ... increasing role in protecting soil and water and enhancing ... from around the world who address an array of ...
... after plucking the fossilized tooth of a new human ... team of scientists today (Thursday, Oct. 1) announced their ... Ardipithecus ramidus , which they say revolutionizes our understanding ... female skeleton, nicknamed Ardi, is 4.4 million years old, ...
... African bees were accidentally released in Brazil in 1957. ... at the Smithsonian Tropical Research Institute, began a 17-year ... to native bees than changes in the weather and ... , Scientists feared that dangerous swarms of Africanized bees ...
Cached Biology News:Tall fescue's future in agriculture 2Ardi displaces Lucy as oldest hominid skeleton 2Ardi displaces Lucy as oldest hominid skeleton 3Ardi displaces Lucy as oldest hominid skeleton 4Ardi displaces Lucy as oldest hominid skeleton 5Killer bees may increase food supplies for native bees 2
(Date:3/27/2015)... NEW YORK , March 27, 2015  Peter ... in Biomedical Science for his pioneering work on how ... the components of a regulatory mechanism that cells use ... proteins. Dr. Walter is a professor of biochemistry at ... the groundwork for treating a range of human diseases ...
(Date:3/27/2015)... March 27, 2015 WuXi PharmaTech (Cayman) ... R&D capability and technology platform company serving the ... today that an Investigational New Drug (IND) application ... rheumatoid arthritis has been accepted for review by ... In September 2012, MedImmune, the global ...
(Date:3/27/2015)... Buffalo, New York (PRWEB) March 27, 2015 ... of the 2015 application period for 43North - the ... cash prizes, including a grand prize of $1 million, ... attracts entrepreneurs from around the world to compete for ... into funded enterprises in the Western New York region. ...
(Date:3/26/2015)... San Bruno, CA (PRWEB) March 26, 2015 ... organization (CRO), announced today several management and executive ... role of Chief Financial Officer (CFO) and member of ... Vice President of Business Operations, and Sue Dowden will ... Tony Taricco, co-founder and current Chief Operations Officer (COO), ...
Breaking Biology Technology:German-born cell biologist Peter Walter wins the 2015 Vilcek Prize in Biomedical Science 2German-born cell biologist Peter Walter wins the 2015 Vilcek Prize in Biomedical Science 3Investigational New Drug Application for WuXi MedImmune's Monoclonal Antibody Accepted for Review by CFDA 2Investigational New Drug Application for WuXi MedImmune's Monoclonal Antibody Accepted for Review by CFDA 3Governor Andrew M. Cuomo Anounces Launch of Year Two of World's Largest Business Idea Competition and Opening of New Incubator Space in Buffalo, New York 2Governor Andrew M. Cuomo Anounces Launch of Year Two of World's Largest Business Idea Competition and Opening of New Incubator Space in Buffalo, New York 3Governor Andrew M. Cuomo Anounces Launch of Year Two of World's Largest Business Idea Competition and Opening of New Incubator Space in Buffalo, New York 4Governor Andrew M. Cuomo Anounces Launch of Year Two of World's Largest Business Idea Competition and Opening of New Incubator Space in Buffalo, New York 5PRC Clinical Announces Key Management Appointments and Launches East Coast Operations 2PRC Clinical Announces Key Management Appointments and Launches East Coast Operations 3
... -- Engineers at Ohio State University are developing a ... same material found in pencils. , Experts believe that ... graphite pencils -- holds the key to smaller, faster ... could enable new kinds of electronics. , Until now, ...
... March 31 Alseres Pharmaceuticals, Inc. (Nasdaq: ... of the Company,s independent registered public accounting firm ... explanatory paragraph regarding the Company,s ability to continue ... NASDAQ-traded companies to publicly announce if their Annual ...
... after heart attackAUSTIN, Texas, March 31 /PRNewswire/ ... Austin treated the first patient in the world ... test the effectiveness and safety of administering adult stem ... heart attack. Dr. Roger Gammon, a cardiologist with ...
Cached Biology Technology:Researchers find better way to manufacture fast computer chips 2Researchers find better way to manufacture fast computer chips 3Alseres Pharmaceuticals, Inc. Complies with NASDAQ Rule Regarding Recently Filed 10-K 2Alseres Pharmaceuticals, Inc. Complies with NASDAQ Rule Regarding Recently Filed 10-K 3Heart Hospital of Austin First Site in World to Test Efficacy of New Adult Stem Cell Therapy to Treat Damaged Heart Tissue in Phase II Trial 2
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: