Navigation Links
New study reveals red grouper to be 'Frank Lloyd Wrights of the sea'
Date:1/19/2010

ies and Wildlife, Oregon State University; and Margaret W. Miller, of the National Marine Fisheries Service, Southeast Fisheries Science Center, Miami, Fla.

"Red grouper are the 'Frank Lloyd Wrights' of the sea floor," said University of California-Davis Professor Susan Williams, who collaborated with Coleman on an earlier, related study. "Its sea-floor associates include commercially valuable species such as vermilion snapper, black grouper and spiny lobsters. If the groupers are overfished, the suite of species that depends on them is likely to suffer."

Working along the West Florida Shelf, Coleman and colleagues observed the red grouper's excavating activities during both its juvenile stage in inshore waters and its adult stage at depths of 300 feet.

Carl Walters, editor-in-chief of The Open Fish Science Journal and a fisheries scientist at the University of British Columbia, points to the study's important implications for fisheries management and biodiversity protection. He said the research reveals the key role red grouper may play, through their modification of fine-scale habitat structure and quality, in the development of biodiversity on Gulf of Mexico reef systems.

"We suspected that the groupers created the habitat," Coleman said. "We found through a series of experiments that they not only dug the holes but also maintained them by carrying mouthfuls of sediment from the center of the pit to the periphery and expelling them through their gills and mouths, then brushing off the rocks with their tail fins."

As juveniles, red grouper excavate the limestone bottom of Florida Bay and elsewhere, exposing "solution holes" formed thousands of years ago when sea level was lower and freshwater dissolved holes in the rock surface. When sea level rose to its present state, the solution holes filled with sediment. By removing the sediment from them, the fish restructure the flat bottom into a three- dimensional matrix
'/>"/>

Contact: Felicia Coleman
coleman@bio.fsu.edu
850-697-4120
Florida State University
Source:Eurekalert  

0

GOOD

Page: 1 2 3

Related biology news :

1. Childhood obesity indicates greater risk of school absenteeism, Penn study reveals
2. A study by the MUHC and McGill University opens a new door to understanding cancer
3. Study begins to reveal clues to the cause and progression of sepsis
4. Clones on task serve greater good, evolutionary study shows
5. New study warns limited carbon market puts 20 percent of tropical forest at risk
6. New study examines how rearing environment can alter navigation
7. Study links cat disease to flame retardants in furniture and to pet food
8. New continent and species discovered in Atlantic study
9. Study shows link between alcohol consumption and hiv disease progression
10. Feeling hot, hot, hot: New study suggests ways to control fever-induced seizures
11. Study finds environmental tests help predict hospital-acquired Legionnaires disease risk
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
New study reveals red grouper to be 'Frank Lloyd Wrights of the sea'
(Date:6/17/2013)... bacteria, and algae, is a common component of sugar-free ... the medical field it,s approved by the FDA ... used during surgery as a substance that opens the ... , Now Profs. Ehud Gazit and Daniel Segal of ... and the Sagol School of Neuroscience, along with their ...
(Date:6/17/2013)... Ore. Amphibian populations are declining worldwide and a ... spread by bullfrogs, but a two-year study shows they ... that bullfrogs are a tolerant carrier host that just ... from eggs in controlled experimental conditions, they found at ... , also called Bd or a chytrid fungus, can ...
(Date:6/16/2013)... were fed a high-fat diet and became obese were ... levels of body fat, a new Ohio University study ... offspring, despite their consumption of a low-fat diet, scientists ... Society in San Francisco, Calif. , "We,ve identified a ... of offspring dependent on the pre-conception diet of the ...
Breaking Biology News(10 mins):Artificial sweetener a potential treatment for Parkinson's disease 2Bullfrogs may help spread deadly amphibian fungus, but also die from it 2Obese male mice father offspring with higher levels of body fat 2
... Saturday 02 April 2011: Data presented at the ... novel antiviral compounds for the treatment of hepatitis ... by experts and specialists to ensure resistance is ... of HCV resistance in patients treated with NS3-protease, ...
... (NASDAQ: AWRE ), a leading supplier of technology ... that Edmund C. Reiter has resigned, effective April 1, 2011, ... board of the company citing personal reasons.   ... have been named co-CEOs and co-Presidents on an interim basis. ...
... huge demands on water resources around the globe. ... major contributor to the nation,s economy, 85% of ... sector. The excessive use of irrigation water has ... where rising demand has deteriorated groundwater resources, depleted ...
Cached Biology News:Data suggest liver experts should take care when prescribing novel antiviral HCV drugs 2Aware, Inc. Announces Resignation of Chief Executive Officer 2Aware, Inc. Announces Resignation of Chief Executive Officer 3Research on satellite imagery aims to advance sustainable agriculture 2
(Date:6/18/2013)... 2013) A million electric cars could be on roads ... the help of research by the United States Department of ... , Professor Zhongwei Chen is part of a team led ... materials to replace the expensive platinum catalysts in fuel cells. ... fuel cells in vehicles is the cost of the units. ...
(Date:6/18/2013)... York, NY (PRWEB) June 18, 2013 ... innovation and sustainability, the Consulate General of Switzerland in ... solar boat, Switzerland’s MS Tûranor PlanetSolar , to ... part of its DeepWater Expedition 2013 tour with scientists ... led by Capitain Gérard d’Aboville, runs exclusively on energy ...
(Date:6/18/2013)... The Regulatory Affairs Professionals Society ... in Asia—one in Singapore and one in Shanghai, China. ... Pan-Asia office , serving the Asia Pacific region, and ... within China. , The announcement comes just a few ... government agencies to develop and implement a new ...
(Date:6/18/2013)... The human skin is the largest organ, ... human body part. Similar to the liver, or heart, the ... repair and grow. Recent reports from the mankatofreepress.com explained how ... as important as other life supporting organs. The article suggests ... cell reproduction, increase the appearance of skin, and fight off ...
Breaking Biology Technology:US and Canadian researchers drive towards cheaper fuel cells for electric cars 2Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 2Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 3Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 4RAPS Opens Offices in Singapore and China 2RAPS Opens Offices in Singapore and China 3Natural Acne Remedies Through Diet, Probiotic Action Shares New Insight on What Foods May Help Lead to Clear Skin 2
... Cynosure, Inc.,(Nasdaq: CYNO ), a leading ... aesthetic treatment systems, today announced that the company,will ... call on Tuesday,February 12, 2008 at 9:00 a.m. ... Executive Officer Michael Davin and,Executive Vice President and ...
... Introduced at Informex 2008, REDWOOD CITY, Calif., ... and leading developer of clean manufacturing,processes, today introduced ... can be used by pharmaceutical companies to more,rapidly ... lead,candidates., The Codex(TM) MicroCyp Plate is being ...
... Phase 1 studies show sobetirome, a selective thyroid hormone ... ... versus placebo, ANN ARBOR, Mich., Jan. 29 QuatRx ... endocrine, metabolic and cardiovascular diseases, today,announced results from two Phase ...
Cached Biology Technology:Cynosure to Announce Fourth-Quarter and Full Year 2007 Financial Results on February 12 2Codexis Launches Codex(TM) MicroCyp Platform to Produce Drug Metabolites and Novel Lead Compounds 2Phase 1 Studies Show Promise of QuatRx's Novel Compound, Sobetirome, for Lowering LDL Cholesterol Levels 2Phase 1 Studies Show Promise of QuatRx's Novel Compound, Sobetirome, for Lowering LDL Cholesterol Levels 3
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: