Navigation Links
New research provides insights into potential ecological costs and cobenefits of REDD
Date:11/16/2009

scenario. Simultaneously, in the zoning-plan based scenario, change in mean annual river discharge is reduced by 50%, mean annual evapotranspiration is increased two-fold, aquatic habitat quality and water quality is increased in 40% of the region's streams, and habitat fragmentation is reduced by nearly two-thirds and interior habitat area is increased by nearly 50%. In contrast, a scenario which prioritizes the protection of riparian areas and extant protected areas and indigenous territories (Protected Area+) without protecting forests on private lands in the region as well, would only achieve emissions reductions of 1.6 million tCO2e over BAU, a more than 200-fold decrease relative to the Zoning scenario. Although aquatic habitat quality and water quality is increased by the same amount as in the Zoning scenario, the gains for regional climate (through evapotranspiration), river discharge regulation, and habitat interior quality are much less.

Overall, these results highlight the importance of the spatial distribution of forest carbon that is protected or restored through REDD. Although the Protected Area+ scenario reduced emissions by less than 2 percent by 2020, it created connectivity across the Xingu headwaters through riparian zone forest restoration, which also provided shade and organic matter inputs to the streams. Protection of hydrological functions of watersheds and forest interior habitats was achieved only when severe restrictions were placed on agricultural and pasture expansion on private lands, as represented in the Zoning scenario. Furthermore, if Zoning-type scenario were to be developed and implemented at a state or national level, the potential threat for leakage to occur would be greatly reduced. Separate analyses indicate that REDD could suppress agricultural expansion in the region with a moderate carbon price.


'/>"/>

Contact: Elizabeth Braun
ebraun@whrc.org
508-540-9900
Woods Hole Research Center
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. ASU research efforts to improve human health will get $3 million in federal stimulus grants
2. Elsevier pilots new research tool Reflect in its premier life science journal Cell
3. Research reveals lipids unexpected role in triggering death of brain cells
4. Researchers gather in the UK to measure the impossible
5. £7.5 million ($12.6 million) collaborations lead UK research communitys response to H1N1 pandemic
6. Carnegie Mellon researchers to develop probes to study cellular GPS
7. Escaped proteins add to hearing loss in elderly, UF researchers find
8. CBS and OMD Partner to Provide the Agency With Access to the Networks Television City Research Facility in Las Vegas
9. Researchers complete draft genome sequence for cassava
10. £3.2m ($5.4 million) research project to capture brilliance of butterfly wings
11. Monell Center joins with CAS to host Beijing meeting on taste and smell research
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:5/19/2015)... , May 19, 2015 ... has announced the addition of the  "Genetic ... offering.  ,     (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , ,A recent ... an in-depth analysis of the current and ... of gene-based tests, their working principles and ...
(Date:5/14/2015)... NEW YORK , May 14, 2015 ... specializing in identity verification and online remote ... Instructure, a software-as-a-service (SaaS) company and creator ... Shared customers of the two companies will ... Proctortrack in Canvas. As a ...
(Date:5/11/2015)... Curemark LLC, a privately held drug research ... Phase III double blind, randomized, placebo-controlled clinical trial to ... all children ages 3-8 with Autism. Previously, Curemark announced ... blinded clinical trial for CM-AT in children ages 3-8 ... enzyme chymotrypsin. This new trial will help determine whether ...
Breaking Biology News(10 mins):Global Genetic Testing Market Outlook 2018 2Verificient and Instructure Announce Alliance Partnership to Provide Online Proctoring for K-12 and Higher Education Institutions 2Curemark, LLC, Launches New Phase III Trial in Expanded Population of Children with Autism 2
... care laws to protect patients, privacy make it nearly ... the safety and usability of medical products by observing ... usability errors and hazards may be overlooked, with the ... Ergonomics in Design, human factors/ergonomics researchers found ...
... between chemicals called phthalates and thyroid hormone levels was ... large-scale and nationally representative study of phthalates and BPA ... The U-M School of Public Health study also reported ... a chemical called bisphenol-A and thyroid hormone levels. BPA ...
... sources of social and emotional support for "everyday people," not ... by the American Psychological Association. And, the study ... in their lives as to their animals, indicating no evidence ... with other people, or that people relied more on pets ...
Cached Biology News:Large human study links phthalates, BPA and thyroid hormone levels 2The truth about cats and dogs: Pets are good for mental health of 'everyday people' 2
(Date:5/21/2015)... 2015 W. R. Grace & ... in Worms, Germany has received good manufacturing practice ... the International Pharmaceutical Excipient Council (IPEC) Foundation. ... its SYLOID® FP brand of pharmaceutical grade excipient ... the Curtis Bay, Maryland (USA) and Sorocaba, Brazil ...
(Date:5/21/2015)... 2015 Research and Markets ( ... "2015 Global Survey on Flow Cytometry Adoption ... The primary goal of this research is to ... reagents. Key information the survey seeks to collect ... cytometers, predominantly used applications for flow cytometers, respondents, ...
(Date:5/20/2015)... , May 20, 2015 Veracyte, ... preliminary data demonstrating the ability of the company,s ... (IPF) from other interstitial lung diseases (ILDs) using ... classifier,s potential to help thousands of patients avoid ... in IPF diagnosis – a frequent challenge for ...
(Date:5/20/2015)... Pa. , May 20, 2015  Select ... that the Federal Trade Commission granted early termination ... Antitrust Improvements Act of 1976, as amended, applicable ... MJ Acquisition Corporation, a joint venture that Select ... L.P. As previously announced, MJ Acquisition ...
Breaking Biology Technology:Grace European Facility Receives GMP Excipient Certification for SYLOID® FP Silica Gel 2Global Survey on Flow Cytometry Adoption Trends 2015 2Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 2Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 3Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 4Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 5Select Medical Corporation's Proposed Acquisition of Concentra Inc. through Joint Venture with Welsh Carson Receives Antitrust Clearance 2
... global,specialty biopharmaceutical company announces results for the year to,December 31, 2008 - a year which has seen significant ... ... Q4 2008 (1), Product sales ... 27% $0.70 bn + 7%(3), Product sales, ...
... NEWARK, Del., Feb. 19 Lightwave Logic, Inc. (OTC ... technology company focused on the development of electro-optic polymer ... optical computing, announced today the addition of Anthony J. ... for 30 years in medicinal chemistry and brings a ...
... most widely used drugs, is also one of the trickiest ... risk of serious problems when given the standard starting dose. ... medicine" based on genetic information, an international research team has ... of the blood-thinning drug for each patient. , Three ...
Cached Biology Technology:Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 2Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 3Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 4Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 5Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 6Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 7Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 8Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 9Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 10Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 11Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 12Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 13Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 14Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 15Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 16Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 17Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 18Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 19Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 20Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 21Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 22Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 23Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 24Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 25Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 26Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 27Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 28Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 29Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 30Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 31Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 32Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 33Lightwave Logic, Inc. Announces the Addition of Anthony J. Cocuzza, PhD to its Technology Team 2Genetic information personalizes warfarin prescribing 2Genetic information personalizes warfarin prescribing 3
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products: