Navigation Links
New international tree nut council study looks at nuts, diabetes and metabolic syndrome
Date:7/31/2014

l in those with diabetes. The PLOS ONE analysis included 12 randomized clinical trials with 450 participants and compared the effects of diets emphasizing tree nuts to isocaloric diets without tree nuts on HbA1c (a marker of longer term blood sugar control), fasting blood glucose, fasting insulin and insulin resistance (HOMA-1R). The results showed that diets emphasizing about two ounces of tree nuts per day significantly lowered HbA1c (P=0.0003) and fasting glucose (P=0.03) compared to the control diets. While neither diet showed significant effects on fasting insulin and insulin resistance, the direction of effect favored tree nuts.

According to Dr. Kendall, "Both of our analyses indicate that daily tree nut consumption has an overall metabolic benefit and can improve risk factors for metabolic syndrome, and glycemic control in individuals with type 2 diabetes."

"With MetS and diabetes on the rise worldwide, this is yet another reason to include tree nuts in your diet every day," states Maureen Ternus, M.S., R.D., Executive Director of the International Tree Nut Council Nutrition Research & Education Foundation (INC NREF). "In 2003, FDA (in its qualified health claim for nuts and heart disease) recommended that people eat 1.5 ounces of nuts per daywell above current consumption levels. We need to encourage peopleespecially those at risk for MetS and those with diabetesto get their handful of nuts every day."


'/>"/>

Contact: Maureen Ternus
maureen.ternus@gmail.com
530-297-5895
Motion PR
Source:Eurekalert

Page: 1 2

Related biology news :

1. OUP to partner with the International College of Neuropsychopharmacology
2. Mount Sinai scientists and international team shed new light on schizophrenia
3. International team sheds new light on biology underlying schizophrenia
4. UC Riverside entomologist receives international honor for chemical ecology contributions
5. Louisiana Tech University professor presents at International Bioprinting Congress
6. Montreal hosts International Union of Microbiology Societies congresses
7. International Space Station researcher guides aim to maximize science
8. Registration is now open for the HFES 2014 International Annual Meeting
9. Largest International Meeting for the Study of Reproductive Biology Attracts Researchers from 36 Countries in Grand Rapids, Michigan
10. International Biometrics Technology Market - Industry Analysis Size Share Growth Trends and Forecast to 2019
11. Marshall University to partner with international company in drug development venture
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/18/2014)... , Nov. 18, 2014   EyeLock Inc. ... solutions, and MorphoTrust USA (Safran), a ... today announced a strategic partnership to offer comprehensive ... vehicle administration (MVA), airport screening and financial services ... solutions, MorphoTrust serves consumers through a nationwide network ...
(Date:11/11/2014)... , Nov. 11, 2014  Forensicon, Inc., a ... firm, is pleased to announce the promotion of ... Director of Digital Forensics. In Schiff,s new role as ... the team of digital forensics examiners and provide leadership ... Photo - http://photos.prnewswire.com/prnh/20141110/157719 ...
(Date:11/7/2014)... Calif. , Nov. 7, 2014  In conjunction with ... Police Departments, The Community Foundation of the Verdugos ... DNA JUSTICE PROJECT," a $250,000 initiative to keep ... initial phase. In its first six months of existence, the ... needed evidence support for local law enforcement. "Because ...
Breaking Biology News(10 mins):EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 2EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 3Yaniv Schiff Promoted to Director of Digital Forensics at Forensicon, Inc. 2Community Foundation Of The Verdugos Unveils Campaign To Fund Glendale-Burbank DNA Justice Project 2
... February 26, 2013, New York, N.Y. and San Diego, Calif. ... tumor in adults, is challenging to treat because the tumors ... more about the causes of tumor cell growth and drug ... new targeted therapies to potentially treat this deadly cancer. ...
... 2013, Reston, VAResearchers will meet at the Society of ... a number of health concerns that have received growing ... of the presentations, scientists will explore how the development ... related exposures might affect the risk assessment of arsenic ...
... Rockville, Md. The Association for Research in Vision ... three keynote speakers, including two Nobel laureates, during the ... Wash. New this year, the ARVO/Alcon Keynote Series ... Christopher Murray, MD, DPhil. Smithies, of the University ...
Cached Biology News:Novel combination therapy shuts down escape route, killing glioblastoma tumor cells 2Scientists explore topical health issues at meeting in Texas 23 distinguished keynote speakers to present during ARVO 2013 Annual Meeting 2
(Date:11/22/2014)... 21, 2014   ... Commercial Officer zu KLOX    ... Chief Financial Officer bestellt    KLOX ... seines jüngst zugelassenen Behandlungssystems zur Wundheilung zu beginnen    ... "Unternehmen") ist sehr erfreut, die folgenden personellen Veränderungen anzukündigen: ...
(Date:11/21/2014)... BELLINGHAM, Washington, USA (PRWEB) November 19, 2014 ... used in our lives was shared with more than ... undergraduate and postgraduate students from the University of Otago ... Outreach Grant . The Otago students, members of the ... Southland New Zealand in early September, giving children from ...
(Date:11/21/2014)... 20, 2014 The California ... research organization representing leading California academic institutions, biotechnology, ... PwC US today released a report revealing ... industry growth. The trend shows a 4 percent ... California Biomedical Industry Report indicates that, while ...
(Date:11/21/2014)... Fayetteville, Arkansas (PRWEB) November 20, 2014 ... partners, Pinnacle Ozone Solutions, LLC (Pinnacle), and PCI, ... equipment, announced that they have been selected to ... City of Fayetteville, Arkansas Paul R. Noland Wastewater ... feature BlueInGreen’s patented HyDOZ® gas dissolution ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Optics and photonics outreach programs share science, spark fascination with light 2Optics and photonics outreach programs share science, spark fascination with light 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 2California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 4City of Fayetteville Leads Nation with Innovative Ozone Technology 2City of Fayetteville Leads Nation with Innovative Ozone Technology 3City of Fayetteville Leads Nation with Innovative Ozone Technology 4
... veteran, was promoted to president of the General Electric Medical ... who left to become CEO at Invitrogen. The division focuses ... systems . , ,It's a dream job for a corporate ... about $9 billion and produced GE CEO and Chairman Jeffery ...
... develops and sells employee scheduling and management products. The ... and co-founder of Suite Scheduler, a former nurse manager ... employees in a facility. , ,Suite Scheduler products are ... up to 90% of the time to create and ...
... That is, until he gets to the better drugs, faster ... the science behind the Madison-based companys products is likely to ... nears the age when diseases and treatments become as common ... the two and a half-year-old company that Vodenlich joined as ...
Cached Biology Technology:CEO Wilson Defines GE's Health-IT Customer 2CEO Wilson Defines GE's Health-IT Customer 3CEO Wilson Defines GE's Health-IT Customer 4Scheduling made easy with Suite Scheduler 2Scheduling made easy with Suite Scheduler 3Chipping Away at Drug Development 2Chipping Away at Drug Development 3
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products: