Navigation Links
New center looks at how human systems function or fail
Date:10/29/2010

he NRNB.

"The field of network biology is at a very interesting stage," Pico said. "We are sitting on loads of measurement data, with new technologies continuously expanding, and we are just beginning to put these 'parts lists' into comprehensive biological systems."

With support from the NIH, the new center will provide qualified researchers with access to more and better tools for conducting advanced studies of biological systems that result in sophisticated models of how human systems function or fail. All of this will ultimately lead to new and improved treatments and therapies, such as identifying disease biomarkers and molecular targets for potential drugs, defining genetic risk factors and deciphering how individual or group lifestyles (social networks) affect the development and transmission of disease.

"We are unique in having a balanced mix of software developers and bench biologists who know how to communicate with each other and with the greater community," said Pico. "We have been building and using the core toolset of NRNB for many years and we've made a regular practice of training others establishing collaborations that drive development along the most fruitful and effective routes."

Like its subject, the NRNB is the product of extensive interaction, with multiple collaborators. They include James Fowler, a UCSD professor in the School of Medicine and Division of Social Sciences who specializes in social networks; Bruce Conklin of The Gladstone Institute of Cardiovascular Disease; Chris Sander of the Memorial Sloan Kettering Cancer Center in New York; Gary Bader of the University of Toronto and Benno Schwikowski of Institut Pasteur in France. Olga Brazhnik of the NCRR is program officer.

The NRNB joins three other NCRR biomedical technology centers based at UC San Diego: the National Center for Microscopy and Imaging Research (Mark H. Ellisman, Director); the National Biomedical Computation Resource (Pe
'/>"/>

Contact: Scott Lafee
slafee@ucsd.edu
619-543-6163
University of California -- San Diego
Source:Eurekalert  

Page: 1 2 3

Related biology news :

1. NIH renews Nanomedicine Center focused on treating single-gene disorders for $16.1 million
2. Knowledge of genetic cancer risks often dies with patients, finds VCU Massey Cancer Center
3. Green Carbon Center takes all-inclusive view of energy
4. Entire issue of scientific journal devoted to center headed by Scripps Research Scientists
5. Center to study effects of plastics chemicals on childrens health
6. Scientists closer to grasping how the brains hearing center spurs responses to sound
7. WUSTLs Living Learning Center shares the worlds first full Living Building certification
8. MU establishes National Botanical Research Center
9. NIH funds Center of Excellence for Molecular Hematology at Cincinnati Childrens
10. Scripps researchers, UCSD chemists to create center devoted to chemistrys influence on climate
11. San Diego Supercomputer Center participates in first Census of Marine Life
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
New center looks at how human systems function or fail
(Date:11/18/2014)... , Nov. 18, 2014   EyeLock Inc. ... solutions, and MorphoTrust USA (Safran), a ... today announced a strategic partnership to offer comprehensive ... vehicle administration (MVA), airport screening and financial services ... solutions, MorphoTrust serves consumers through a nationwide network ...
(Date:11/11/2014)... , Nov. 11, 2014  Forensicon, Inc., a ... firm, is pleased to announce the promotion of ... Director of Digital Forensics. In Schiff,s new role as ... the team of digital forensics examiners and provide leadership ... Photo - http://photos.prnewswire.com/prnh/20141110/157719 ...
(Date:11/7/2014)... Calif. , Nov. 7, 2014  In conjunction with ... Police Departments, The Community Foundation of the Verdugos ... DNA JUSTICE PROJECT," a $250,000 initiative to keep ... initial phase. In its first six months of existence, the ... needed evidence support for local law enforcement. "Because ...
Breaking Biology News(10 mins):EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 2EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 3Yaniv Schiff Promoted to Director of Digital Forensics at Forensicon, Inc. 2Community Foundation Of The Verdugos Unveils Campaign To Fund Glendale-Burbank DNA Justice Project 2
... February 26, 2013, New York, N.Y. and San Diego, Calif. ... tumor in adults, is challenging to treat because the tumors ... more about the causes of tumor cell growth and drug ... new targeted therapies to potentially treat this deadly cancer. ...
... 2013, Reston, VAResearchers will meet at the Society of ... a number of health concerns that have received growing ... of the presentations, scientists will explore how the development ... related exposures might affect the risk assessment of arsenic ...
... Rockville, Md. The Association for Research in Vision ... three keynote speakers, including two Nobel laureates, during the ... Wash. New this year, the ARVO/Alcon Keynote Series ... Christopher Murray, MD, DPhil. Smithies, of the University ...
Cached Biology News:Novel combination therapy shuts down escape route, killing glioblastoma tumor cells 2Scientists explore topical health issues at meeting in Texas 23 distinguished keynote speakers to present during ARVO 2013 Annual Meeting 2
(Date:11/22/2014)... 21, 2014   ... Commercial Officer zu KLOX    ... Chief Financial Officer bestellt    KLOX ... seines jüngst zugelassenen Behandlungssystems zur Wundheilung zu beginnen    ... "Unternehmen") ist sehr erfreut, die folgenden personellen Veränderungen anzukündigen: ...
(Date:11/21/2014)... BELLINGHAM, Washington, USA (PRWEB) November 19, 2014 ... used in our lives was shared with more than ... undergraduate and postgraduate students from the University of Otago ... Outreach Grant . The Otago students, members of the ... Southland New Zealand in early September, giving children from ...
(Date:11/21/2014)... 20, 2014 The California ... research organization representing leading California academic institutions, biotechnology, ... PwC US today released a report revealing ... industry growth. The trend shows a 4 percent ... California Biomedical Industry Report indicates that, while ...
(Date:11/21/2014)... Fayetteville, Arkansas (PRWEB) November 20, 2014 ... partners, Pinnacle Ozone Solutions, LLC (Pinnacle), and PCI, ... equipment, announced that they have been selected to ... City of Fayetteville, Arkansas Paul R. Noland Wastewater ... feature BlueInGreen’s patented HyDOZ® gas dissolution ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Optics and photonics outreach programs share science, spark fascination with light 2Optics and photonics outreach programs share science, spark fascination with light 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 2California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 4City of Fayetteville Leads Nation with Innovative Ozone Technology 2City of Fayetteville Leads Nation with Innovative Ozone Technology 3City of Fayetteville Leads Nation with Innovative Ozone Technology 4
... veteran, was promoted to president of the General Electric Medical ... who left to become CEO at Invitrogen. The division focuses ... systems . , ,It's a dream job for a corporate ... about $9 billion and produced GE CEO and Chairman Jeffery ...
... develops and sells employee scheduling and management products. The ... and co-founder of Suite Scheduler, a former nurse manager ... employees in a facility. , ,Suite Scheduler products are ... up to 90% of the time to create and ...
... That is, until he gets to the better drugs, faster ... the science behind the Madison-based companys products is likely to ... nears the age when diseases and treatments become as common ... the two and a half-year-old company that Vodenlich joined as ...
Cached Biology Technology:CEO Wilson Defines GE's Health-IT Customer 2CEO Wilson Defines GE's Health-IT Customer 3CEO Wilson Defines GE's Health-IT Customer 4Scheduling made easy with Suite Scheduler 2Scheduling made easy with Suite Scheduler 3Chipping Away at Drug Development 2Chipping Away at Drug Development 3
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products: