Navigation Links
New book from NJIT professor focuses on art, science and evolution
Date:10/21/2011

NJIT Professor David Rothenberg's newest book "Survival of the Beautiful: Art, Science, and Evolution" (Bloomsbury Press) will be released at the end of this month. Advance reviewers have called the book a freewheeling discussion of the role of aesthetics in evolution and a celebration of the beauty to be found in the great diversity of life.

Taking inspiration from Darwin's observations that animals have a natural aesthetic sense, Rothenberg probes why animals, humans included, have an innate appreciation for beauty -- and why nature is beautiful.

Sexual selection may explain why animals desire, but it says very little about what they desire, says Rothenberg. Questions the book raises include the following: Why will a bowerbird literally murder another bird to decorate its bower with the victim's blue feathers? Why do butterfly wings boast such brilliantly varied patterns?

The beauty of nature is not arbitrary, even if random mutation has played a role in evolution. What we can learn from the amazing range of animal aesthetic behavior -- about animals, and about ourselves -- are just a few of the many questions the book raises.

Rothenberg teaches philosophy and music at NJIT. His most recent book, "Thousand Mile Song: Whale Music in a Sea of Sound" (Basic Books, 2008), and the same-named CD, chronicled the rich, underwater universe of whale sound. To produce the material, Rothenberg traveled from Hawaii to Russia to play his bass clarinet while recording the sounds of whales in their native habitats. Booklist, a publication of the American Library Association, named the text one of the ten best science and technology books for 2008.

"Why Birds Sing" (Basic Books, 2005) was Rothenberg's first general interest book to examine bird song from the combined perspectives of science, music, and poetry and the culmination of his interdisciplinary work since he began teaching at NJIT in 1992. Why Birds Sing has
'/>"/>

Contact: Sheryl Weinstein
973-596-3436
New Jersey Institute of Technology
Source:Eurekalert

Page: 1 2

Related biology news :

1. UT professor elected to the Institute of Medicine of the National Academies
2. Recognition for 7 Concordia professors
3. Professor Peter J. Coffeys stem cell therapy for Age-Related Macular Degeneration expected to begin clinical trials in 2012
4. Professor Doug Hilton wins Milstein Award for cytokine research
5. University of Toronto Mississauga professor wins Ig Nobel Prize for beer, sex research
6. WPI mathematics professor Dalin Tang elected a Fellow of the American Heart Association
7. NJIT professor working with graphene, carbon nanotubes to receive honor
8. BUSM professor authors book on how knowledge about genes and family history can save lives
9. BUSM professor awarded $13.3 million to study potential treatments to prevent STDs
10. FASEB MARC program announces the travel award recipients for the 2011 Leadership Development and Grant Writing Seminar for graduate students, postdoctoral fellows and new assistant professors
11. MSU professor launches new field of water research, nets $2.2 million NSF grant
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:8/20/2014)... LAKE CITY Researchers at Huntsman Cancer Institute (HCI) at ... forms of the gene that encodes BCR-ABL, the unregulated ... According to the American Cancer Society, nearly 6,000 new ... Drugs already in use, called tyrosine kinase inhibitors (TKIs), ... They do not cure CML but control it in ...
(Date:8/20/2014)... State University, the Wellcome Trust Sanger Institute and the ... Mycobacterium pinnipedii from skeletons found in Peru ... is a relative of the TB bacterium that affects ... These researchers assume that seals carried the pathogens from ... lions was unexpected" comments Sebastien Gagneux, from the Swiss ...
(Date:8/20/2014)... Bay Area Lyme Foundation, which aims to make Lyme ... new research published in an upcoming issue of the ... . The findings show that ticks that carry ... year, making the threat of Lyme disease year-round. The ... Public Health (CDPH) Vector-borne Disease Section and University of ...
Breaking Biology News(10 mins):Blueprint for next generation of chronic myeloid leukemia treatment 2Lyme disease risk is year-round in Northwest California, according to new study 2Lyme disease risk is year-round in Northwest California, according to new study 3
... Following an agreement between ESA, Krunichev Space Centre and ... and a secondary payload, the technology demonstrator Proba-2 satellite, ... new November launch date follows a rescheduling of the ... Moisture and Ocean Salinity (SMOS) satellite and the secondary ...
... heat shock protein 90 gets steroid receptors into shape ... to targeted therapies for hormone-driven cancers, such as breast ... of Georgia researchers say. "We are trying to ... conformation so they work," says Dr. Ahmed Chadli, biochemist ...
... In the fruit fly,s developing brain, stem cells called ... cell that has a different fate. But neuroblast growth can ... Researchers at Duke-NUS Graduate Medical School in Singapore ... a counterpart in mammals, that can apparently prevent brain tumors ...
Cached Biology News:SMOS and Proba-2 launch rescheduled for November 2Targeting helpers of heat shock proteins could help treat cancer, cardiovascular disease 2Tumor suppressor gene in flies may provide insights for human brain tumors 2
(Date:8/21/2014)... His Majesty Willem-Alexander, King of the Netherlands ... His Majesty Willem-Alexander, King of the Netherlands, has announced ... POET-DSM Advanced Biofuels’ Project LIBERTY cellulosic ethanol plant in ... will take part in the Grand Opening Ceremony to ... p.m. and tour the plant. POET-DSM is a joint ...
(Date:8/21/2014)... , Aug. 21, 2014  Decision Resources ... Brazil and Mexico ... uptake of several newly approved agents, the anticipated ... indication and the launch of emerging biologics will ... In particular, the emerging IL-5 inhibitors will introduce ...
(Date:8/21/2014)... -- China Cord Blood Corporation (NYSE: CO ) ... results for the first quarter of fiscal year 2015 ... the US.  The Company will host ... August 29, 2014 to discuss its financial performance and ... followed by a question and answer session.  Interested parties ...
(Date:8/21/2014)... 2014 Ontotext S4 , The ... Ontotext . Now the same enterprise hardened text ... and unstructured data is available to start-ups and mid-size ... technology. Organizations that do not have resources to evaluate ... use S4 since there is no need for on ...
Breaking Biology Technology:His Majesty Willem-Alexander, King of the Netherlands, to Attend Project LIBERTY opening 2His Majesty Willem-Alexander, King of the Netherlands, to Attend Project LIBERTY opening 3Asthma Agents Currently Face a Suboptimal Coverage Environment in Brazil and Mexico, and as the Treatment Armamentarium Expands, Competitiveness Will Further Intensify 2Asthma Agents Currently Face a Suboptimal Coverage Environment in Brazil and Mexico, and as the Treatment Armamentarium Expands, Competitiveness Will Further Intensify 3China Cord Blood Corporation to Report First Quarter of Fiscal 2015 Financial Results 2Ontotext Releases Text Mining & Semantic Technology Running in the Cloud – Welcome to “S4? 2Ontotext Releases Text Mining & Semantic Technology Running in the Cloud – Welcome to “S4? 3Ontotext Releases Text Mining & Semantic Technology Running in the Cloud – Welcome to “S4? 4
... Yingxia,International, Inc. (OTC Bulletin Board: CYXI) ("China Yingxia" ... and nutritional food industry,engaged in the development, manufacture ... raw cactus plants in the People,s,Republic of China ... Ren,Hu will present at the upcoming Roth China ...
... Wall St. Network,s 3-Minute,Press Show is a daily program ... with public company executives on their,company and most recent ... viewers with insight into a company,s,latest news, and its ... Shows air Monday through Friday at: http://tv.wallst.net/3-min-press/3-min-press.php ...
... device company focused on developing, and commercializing interventional ... call scheduled for Tuesday, November 4, 2008 at ... PAUL, Minn., Nov. 4 ,Replidyne, Inc. (Nasdaq: ... that they have entered into a definitive merger ...
Cached Biology Technology:China Yingxia to Present at Roth China Comes to Vegas Conference 2[video] Wall St. Network's 3-Minute Press Show Features Executive Interviews and Highlights Recent Press for the Following: GTHR, BHRT, AGO 2Replidyne and Cardiovascular Systems Sign Merger Agreement 2Replidyne and Cardiovascular Systems Sign Merger Agreement 3Replidyne and Cardiovascular Systems Sign Merger Agreement 4Replidyne and Cardiovascular Systems Sign Merger Agreement 5Replidyne and Cardiovascular Systems Sign Merger Agreement 6Replidyne and Cardiovascular Systems Sign Merger Agreement 7
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Rabbit polyclonal antibody to GluR2...
Biology Products: